Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2) (C-Term) antibody

Details for Product No. ABIN311108
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CFC4, MAPKK2, MEK2, MKK2, PRKMK2, AA589381, MK2, Prkmk2
Epitope
C-Term
(37), (12), (7), (7), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(141), (94), (86), (12), (3), (2), (1)
Host
Rabbit
(122), (24)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(114), (45), (40), (31), (30), (24), (22), (8), (7), (4), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN311108
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human MAP2K2
Sequence IKNPAERADLKMLTNHTFIKRSEVEEVDFAGWLCKTLRLN QPGTPTRTAV
Predicted Reactivity Human : 100 %, Bovine : 90 %, Chicken : 90 %, Horse : 90 %, Pig : 90 %, Guinea pig : 90 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against MAP2K2. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name MAP2K2
Background MAP2K2 is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in MAP2K2 gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.The protein encoded by this gene is a dual specificity protein kinase that belongs to the MAP kinase kinase family. This kinase is known to play a critical role in mitogen growth factor signal transduction. It phosphorylates and thus activates MAPK1/ERK2 and MAPK2/ERK3. The activation of this kinase itself is dependent on the Ser/Thr phosphorylation by MAP kinase kinase kinases. Mutations in this gene cause cardiofaciocutaneous syndrome (CFC syndrome), a disease characterized by heart defects, mental retardation, and distinctive facial features similar to those found in Noonan syndrome. The inhibition or degradation of this kinase is also found to be involved in the pathogenesis of Yersinia and anthrax. A pseudogene, which is located on chromosome 7, has been identified for this gene.
Molecular Weight 44 kDa
Gene ID 5605
NCBI Accession NM_030662, NP_109587
UniProt P36507
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 400 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Mitogen-Activated Protein Kinase Kinase 2 (MAP2K2) (C-Term) antibody WB Suggested Anti-MAP2K2 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
Background publications Adjei, Cohen, Franklin et al.: "Phase I pharmacokinetic and pharmacodynamic study of the oral, small-molecule mitogen-activated protein kinase kinase 1/2 inhibitor AZD6244 (ARRY-142886) in patients with advanced cancers." in: Journal of clinical oncology : official journal of the American Society of Clinical Oncology, Vol. 26, Issue 13, pp. 2139-46, 2008 (PubMed).

Hosts (122), (24)
Reactivities (141), (94), (86), (12), (3), (2), (1)
Applications (114), (45), (40), (31), (30), (24), (22), (8), (7), (4), (2), (2), (1), (1)
Conjugates (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Epitopes (37), (12), (7), (7), (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top