Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12) (C-Term) antibody

Details for Product No. ABIN311110
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 0610016O18Rik
Epitope
C-Term
(2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(5), (2), (2)
Host
Rabbit
(4), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN311110
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human NUDT12
Sequence LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFF VPPSRAIAHQ
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against NUDT12. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name NUDT12
Background Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances (Abdelraheim et al., 2003 [PubMed 12790796]).
Molecular Weight 52 kDa
Gene ID 83594
NCBI Accession NM_031438, NP_113626
UniProt Q9BQG2
Research Area Signaling, Metabolism, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 462 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12) (C-Term) antibody WB Suggested Anti-NUDT12 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Hosts (4), (2)
Reactivities (5), (2), (2)
Applications (6), (3), (1)
Epitopes (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top