Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311110

Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 0610016O18Rik
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311110
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NUDT12 antibody: synthetic peptide directed towards the C terminal of human NUDT12
Sequence LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFF VPPSRAIAHQ
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Chicken : 76%
Characteristics This is a rabbit polyclonal antibody against NUDT12. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name NUDT12
Background Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances (Abdelraheim et al., 2003 [PubMed 12790796]).
Molecular Weight 52kDa
Gene ID 83594
NCBI Accession NP_113626, NM_031438
UniProt Q9BQG2
Research Area Signaling, Metabolism, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NUDT12 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12)", type "Antibodies"
Hosts (4), (2)
Reactivities (5), (2), (2)
Applications (6), (4), (1)
Epitopes (2), (1)
Beacon