Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12) antibody

Antigen: Nudix (Nucleoside Diphosphate Linked Moiety X)-Type Motif 12 (NUDT12)

Synonyms: DKFZp761I172, NUDT12, DKFZp469J0915

Clonality: Polyclonal

Host: Rabbit

Reactivity: Cow (Bovine), Human, Mouse (Murine), Rat (Rattus), Dog (Canine), Chicken

Application: Western Blotting (WB)

Catalog no.: ABIN311110

Additional Information

Alternative name: NUDT12

Gene ID: NUDT12

UniProt: Q9BQG2

Immunogen: The immunogen for anti-NUDT12 antibody: synthetic peptide directed towards the C terminal of human NUDT12

Sequence: LALAVSTEIKVDKNEIEDARWFTREQVLDVLTKGKQQAFF VPPSRAIAHQ

Cross-Reactivity: Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)

Format: Lyophilized

Reconstitution: Add 100 µl of distilled water. Final anti-NUDT12 antibody concentration is 1 mg/ml.

Description: Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances.Nucleotides are involved in numerous biochemical reactions and pathways within the cell as substrates, cofactors, and effectors. Nudix hydrolases, such as NUDT12, regulate the concentrations of individual nucleotides and of nucleotide ratios in response to changing circumstances (Abdelraheim et al., 2003 [PubMed 12790796]).[supplied by OMIM]. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-299 CB131118.1 1-299 300-344 BC041099.1 296-340 345-492 CB131118.1 345-492 493-993 BC041099.1 489-989 994-1171 BU621954.1 461-638 1172-3502 BC026748.1 206-2536

Characteristics: Antigen Size: 462 amino acids

Molecular Weight: 52kDa

Application Details

Application Notes: WB Suggested Anti-NUDT12 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate.

Purification: Protein A purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Research Area: Signaling, Metabolism, Organelles

Restrictions: For Research Use only

Images

WB Suggested Anti-NUDT12 Antibody Titration: 2.5ug/ml
Positive Control: HepG2 cell lysate

Publications

Product: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).