Glycosyltransferase-Like Domain Containing 2 (GTDC2) (Middle Region) antibody

Details for Product No. ABIN311114
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms AGO61, C3orf39, GTDC2, MDDGA8, Ago61, C85492, RGD1304827
Epitope
Middle Region
(3), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(19), (15), (15), (15), (12), (3), (1)
Host
Rabbit
(18), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(11), (10), (3), (3), (2)
Pubmed 2 references available
Catalog no. ABIN311114
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C3orf39
Sequence TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQY VAWRNMMPEN
Predicted Reactivity Bovine : 100 %
Characteristics This is a rabbit polyclonal antibody against C3orf39. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name C3orf39
Background The function remains unknown.
Molecular Weight 66 kDa
Gene ID 84892
NCBI Accession NM_032806, NP_116195
UniProt Q8NAT1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 580 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Glycosyltransferase-Like Domain Containing 2 (GTDC2) (Middle Region) antibody WB Suggested Anti-C3orf39 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Hosts (18), (2)
Reactivities (19), (15), (15), (15), (12), (3), (1)
Applications (11), (10), (3), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1)
back to top