Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311114

Glycosyltransferase-Like Domain Containing 2 (GTDC2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms AGO61, C3orf39, GTDC2, MDDGA8, Ago61, C85492, RGD1304827
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN311114
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-C3orf39 antibody: synthetic peptide directed towards the middle region of human C3orf39
Sequence TTLFLPRGATVVELFPYAVNPDHYTPYKTLAMLPGMDLQY VAWRNMMPEN
Predicted Reactivity Bovine : 100%
Characteristics This is a rabbit polyclonal antibody against C3orf39. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name C3orf39
Background The function remains unknown.
Molecular Weight 66kDa
Gene ID 84892
NCBI Accession NP_116195, NM_032806
UniProt Q8NAT1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-C3orf39 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Gerhard, Wagner, Feingold et al.: "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." in: Genome research, Vol. 14, Issue 10B, pp. 2121-7, 2004 (PubMed).

Background publications Gunnarsdóttir, Li, Bauchet et al.: "High-throughput sequencing of complete human mtDNA genomes from the Philippines." in: Genome research, Vol. 21, Issue 1, pp. 1-11, 2011 (PubMed).

Alternatives for antigen "Glycosyltransferase-Like Domain Containing 2 (GTDC2)", type "Antibodies"
Hosts (18), (2)
Reactivities (19), (15), (15), (15), (12), (3), (1)
Applications (11), (10), (4), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (1), (1)
Beacon