Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311118

Transglutaminase 7 (TGM7) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TGMZ, TGz, TGM7
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311118
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TGM7 antibody: synthetic peptide directed towards the C terminal of human TGM7
Sequence TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKL IRVSGIAEVE
Predicted Reactivity Human : 100%, Dog : 92%, Pig : 92%, Rabbit : 92%, Guinea pig : 85%, Mouse : 84%, Horse : 78%
Characteristics This is a rabbit polyclonal antibody against TGM7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TGM7
Background Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon��lysine crosslinks. Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks. For additional background information on transglutaminases, see TGM1 (MIM 190195).
Molecular Weight 80kDa
Gene ID 116179
NCBI Accession NP_443187, NM_052955
UniProt Q96PF1
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TGM7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grenard, Bates, Aeschlimann: "Evolution of transglutaminase genes: identification of a transglutaminase gene cluster on human chromosome 15q15. Structure of the gene encoding transglutaminase X and a novel gene family member, transglutaminase Z." in: The Journal of biological chemistry, Vol. 276, Issue 35, pp. 33066-78, 2001 (PubMed).

Alternatives for antigen "Transglutaminase 7 (TGM7)", type "Antibodies"
Hosts (13), (3), (2), (1)
Reactivities (18), (9), (1), (1), (1), (1)
Applications (19), (16), (6), (6), (2)
Conjugates (1)
Epitopes (3), (1), (1), (1)
Beacon