Did you know that you can buy products from over 140 different suppliers from us?

Transglutaminase 7 (TGM7) (C-Term) antibody

Details for Product No. ABIN311118
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TGM7, TGMZ, TGz
Epitope
C-Term
(3), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Human
(20), (8), (1), (1)
Host
Rabbit
(14), (3), (2), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1)
Application
Western Blotting (WB)
(21), (16), (6), (6), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311118
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human TGM7
Sequence TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKL IRVSGIAEVE
Predicted Reactivity Human : 100 %, Dog : 90 %, Pig : 90 %, Rabbit : 90 %, Guinea pig : 80 %, Mouse : 80 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against TGM7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TGM7
Background Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon��lysine crosslinks. Transglutaminases (TGM, EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks. For additional background information on transglutaminases, see TGM1 (MIM 190195).
Molecular Weight 80 kDa
Gene ID 116179
NCBI Accession NM_052955, NP_443187
UniProt Q96PF1
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 710 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Transglutaminase 7 (TGM7) (C-Term) antibody WB Suggested Anti-TGM7 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Background publications Grenard, Bates, Aeschlimann: "Evolution of transglutaminase genes: identification of a transglutaminase gene cluster on human chromosome 15q15. Structure of the gene encoding transglutaminase X and a novel gene family member, transglutaminase Z." in: The Journal of biological chemistry, Vol. 276, Issue 35, pp. 33066-78, 2001 (PubMed).

Validation Images
back to top