Sulfatase 2 (SULF2) (C-Term) antibody

Details for Product No. ABIN311170
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HSULF-2, 2010004N24Rik, AU020235, MSulf-2, mKIAA1247, xtsulf2, Sulf1, zgc:55612, SULF2, si:dkeyp-84g9.1, wu:fb48e04
Epitope
C-Term
(4), (3), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
(34), (22), (14), (12), (12), (12), (12)
Host
Rabbit
(28), (7), (4)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(28), (15), (12), (10), (5), (5), (4), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN311170
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SULF2
Sequence DVLNQLHVQLMELRSCKGYKQCNPRTRNMDLGLKDGGSYE QYRQFQRRKW
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Rabbit : 100 %, Chicken : 90 %, Mouse : 90 %, Rat : 90 %, African clawed frog : 70 %, Bovine : 70 %
Characteristics This is a rabbit polyclonal antibody against SULF2. It was validated on Western Blot and immunohistochemistry.
Purification Protein A purified
Alternative Name SULF2
Background Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules.Heparan sulfate proteoglycans (HSPGs) act as coreceptors for numerous heparin-binding growth factors and cytokines and are involved in cell signaling. Heparan sulfate 6-O-endosulfatases, such as SULF2, selectively remove 6-O-sulfate groups from heparan sulfate. This activity modulates the effects of heparan sulfate by altering binding sites for signaling molecules (Dai et al., 2005 [PubMed 16192265]).
Molecular Weight 98 kDa
Gene ID 55959
NCBI Accession NM_018837, NP_061325
UniProt Q8IWU5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 870 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sulfatase 2 (SULF2) (C-Term) antibody anti-Sulfatase 2 (SULF2) (C-Term) antibody
anti-Sulfatase 2 (SULF2) (C-Term) antibody (2) anti-Sulfatase 2 (SULF2) (C-Term) antibody (Image 2)
Product cited in: Uchimura, Morimoto-Tomita, Bistrup et al.: "HSulf-2, an extracellular endoglucosamine-6-sulfatase, selectively mobilizes heparin-bound growth factors and chemokines: effects on VEGF, FGF-1, and SDF-1." in: BMC biochemistry, Vol. 7, pp. 2, 2006 (PubMed).

Hosts (28), (7), (4)
Reactivities (34), (22), (14), (12), (12), (12), (12)
Applications (28), (15), (12), (10), (5), (5), (4), (3), (3), (1)
Conjugates (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top