Did you know that you can buy products from over 140 different suppliers from us?

Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) antibody

Details for Product No. ABIN311175
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PCDH-GAMMA-A4, Pcdhga3
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Cow (Bovine), Human, Chicken
(19), (17), (17), (17), (17), (17)
Host
Rabbit
(19), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(15), (14), (6), (3), (3), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN311175
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PCDHGA4
Sequence GDPVRSGTARILIILVDTNDNAPVFTQPEYHVSVRENVPV GTRLLTVKAT
Predicted Reactivity Mouse : 100 %
Characteristics This is a rabbit polyclonal antibody against PCDHGA4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PCDHGA4
Background PCDHGA4 is a single-pass type I membrane protein. It contains 6 cadherin domains. PCDHGA4 is a potential calcium-dependent cell-adhesion protein. It may be involved in the establishment and maintenance of specific neuronal connections in the brain.This gene is a member of the protocadherin gamma gene cluster, one of three related clusters tandemly linked on chromosome five. These gene clusters have an immunoglobulin-like organization, suggesting that a novel mechanism may be involved in their regulation and expression. The gamma gene cluster includes 22 genes divided into 3 subfamilies. Subfamily A contains 12 genes, subfamily B contains 7 genes and 2 pseudogenes, and the more distantly related subfamily C contains 3 genes. The tandem array of 22 large, variable region exons are followed by a constant region, containing 3 exons shared by all genes in the cluster. Each variable region exon encodes the extracellular region, which includes 6 cadherin ectodomains and a transmembrane region. The constant region exons encode the common cytoplasmic region. These neural cadherin-like cell adhesion proteins most likely play a critical role in the establishment and function of specific cell-cell connections in the brain. Alternative splicing has been described for the gamma cluster genes.
Molecular Weight 86 kDa
Gene ID 56111
NCBI Accession NM_032053, NP_114442
UniProt Q9Y5G9-2
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 820 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Protocadherin gamma Subfamily A, 4 (PCDHGA4) (N-Term) antibody WB Suggested Anti-PCDHGA4 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Wu, Zhang, Cheng et al.: "Comparative DNA sequence analysis of mouse and human protocadherin gene clusters." in: Genome research, Vol. 11, Issue 3, pp. 389-404, 2001 (PubMed).

Hosts (19), (1)
Reactivities (19), (17), (17), (17), (17), (17)
Applications (15), (14), (6), (3), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311175
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top