Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311190

Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LALP1, Lysal2, 1810012B13Rik, 1810020C02Rik, 2810003F23Rik, RP11-483F11.1, NTPDase7
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311190
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ENTPD7 antibody: synthetic peptide directed towards the C terminal of human ENTPD7
Sequence EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDR EVQWTLGAIL
Predicted Reactivity Bovine : 100%, Guinea pig : 100%, Pig : 100%, Rat : 100%, Dog : 92%, Rabbit : 92%, Chicken : 76%
Characteristics This is a rabbit polyclonal antibody against ENTPD7. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ENTPD7
Background ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.
Molecular Weight 69kDa
Gene ID 57089
NCBI Accession NP_065087, NM_020354
UniProt Q9NQZ7
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ENTPD7 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Alternatives for antigen "Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7)", type "Antibodies"
Hosts (5)
Reactivities (3), (2)
Applications (5), (1)
Epitopes (3), (1)
Beacon