Ectonucleoside Triphosphate diphosphohydrolase 7 (ENTPD7) (C-Term) antibody

Details for Product No. ABIN311190
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LALP1, Lysal2, 1810012B13Rik, 1810020C02Rik, 2810003F23Rik, RP11-483F11.1, NTPDase7
Epitope
C-Term
(3), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
(3), (2)
Host
Rabbit
(5)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5)
Pubmed 1 reference available
Catalog no. ABIN311190
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human ENTPD7
Sequence EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDR EVQWTLGAIL
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Pig : 100 %, Rat : 100 %, Dog : 90 %, Rabbit : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against ENTPD7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ENTPD7
Background ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.
Molecular Weight 69 kDa
Gene ID 57089
NCBI Accession NM_020354, NP_065087
UniProt Q9NQZ7
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 604 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Deloukas, Earthrowl, Grafham et al.: "The DNA sequence and comparative analysis of human chromosome 10...." in: Nature, Vol. 429, Issue 6990, pp. 375-81, 2004 (PubMed).

Hosts (5)
Reactivities (3), (2)
Applications (5)
Epitopes (3), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top