Did you know that you can buy products from over 140 different suppliers from us?

Neuroligin 4, X-Linked (NLGN4X) (N-Term) antibody

Details for Product No. ABIN311201
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms nlgn4, NLGN4X, NL-4, NL4, Nlgn4, Nlgn4x, ASPGX2, AUTSX2, HLNX, HNL4X, NLGN4
Epitope
N-Term
(4), (2), (2), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Xenopus laevis, Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(33), (19), (18), (18), (17), (2), (1), (1), (1)
Host
Rabbit
(27), (5), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (15), (14), (6), (4), (3), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311201
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NLGN4X
Sequence SILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQ IQALRWIEEN
Predicted Reactivity Chicken : 100 %, Horse : 100 %, Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against NLGN4X. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NLGN4X
Background NLGN4X is a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. It interacts with discs, large (Drosophila) homolog 4 (DLG4). NLGN4X might play a role in the autism and Asperger syndrome. This gene encodes a member of a family of neuronal cell surface proteins. Members of this family may act as splice site-specific ligands for beta-neurexins and may be involved in the formation and remodeling of central nervous system synapses. The encoded protein interacts with discs, large (Drosophila) homolog 4 (DLG4). Mutations in this gene have been associated with autism and Asperger syndrome. Two transcript variants encoding the same protein have been identified for this gene.
Molecular Weight 92 kDa
Gene ID 57502
NCBI Accession NM_020742, NP_065793
UniProt Q8NFZ3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 816 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Neuroligin 4, X-Linked (NLGN4X) (N-Term) antibody WB Suggested Anti-NLGN4X Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Background publications Wermter, Kamp-Becker, Strauch et al.: "No evidence for involvement of genetic variants in the X-linked neuroligin genes NLGN3 and NLGN4X in probands with autism spectrum disorder on high functioning level." in: American journal of medical genetics. Part B, Neuropsychiatric genetics : the official publication of the International Society of Psychiatric Genetics, Vol. 147B, Issue 4, pp. 535-7, 2008 (PubMed).

Validation Images
back to top