Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311210

Signal Recognition Particle Receptor, B Subunit (SRPRB) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms APMCF1, AA409543, Cc1-8, Ab2-417, Ba1-667, wu:fk57h10, zgc:111820, zgc:92746, apmcf1
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311210
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SRPRB antibody: synthetic peptide directed towards the C terminal of human SRPRB
Sequence APAQLGKKGKEFEFSQLPLKVEFLECSAKGGRGDVGSADI QDLEKWLAKI
Predicted Reactivity Human : 100%, Mouse : 92%, Rabbit : 92%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against SRPRB. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SRPRB
Background SRPRB has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.The protein encoded by this gene has similarity to mouse protein which is a subunit of the signal recognition particle receptor (SR). This subunit is a transmembrane GTPase belonging to the GTPase superfamily. It anchors alpha subunit, a peripheral membrane GTPase, to the ER membrane. SR is required for the cotranslational targeting of both secretory and membrane proteins to the ER membrane.
Molecular Weight 30kDa
Gene ID 58477
NCBI Accession NP_067026, NM_021203
UniProt Q9Y5M8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SRPRB antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Ewing, Chu, Elisma et al.: "Large-scale mapping of human protein-protein interactions by mass spectrometry." in: Molecular systems biology, Vol. 3, pp. 89, 2007 (PubMed).

Alternatives for antigen "Signal Recognition Particle Receptor, B Subunit (SRPRB)", type "Antibodies"
Hosts (12), (5), (5)
Reactivities (16), (6), (3), (3), (3), (1), (1), (1)
Applications (22), (5), (3), (2), (1), (1), (1), (1), (1)
Epitopes (5), (2), (2), (2), (1), (1), (1), (1)
Beacon