Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311257

Lipase Maturation Factor 2 (LMF2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tmem112b, RGD1306274, xlmf2, BC002942, lmf2, tmem153, tmem112b, im:7150505, im:7152257, TMEM153, TMEM112B, Tmem153, AI451006, zgc:194766, MGC145062
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311257
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-LMF2 antibody: synthetic peptide directed towards the middle region of human LMF2
Sequence YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLG GRPEVVLEGS
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%, African clawed frog : 90%
Characteristics This is a rabbit polyclonal antibody against LMF2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name LMF2
Background LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.
Molecular Weight 77kDa
Gene ID 91289
NCBI Accession NP_149977, NM_033200
UniProt Q9BU23
Research Area Signaling, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-LMF2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Lipase Maturation Factor 2 (LMF2)", type "Antibodies"
Hosts (8)
Reactivities (7), (2), (2)
Applications (8), (4), (4), (2)
Epitopes (4), (2), (2), (1)
Beacon