Lipase Maturation Factor 2 (LMF2) (Middle Region) antibody

Details for Product No. ABIN311257
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Tmem112b, RGD1306274, xlmf2, BC002942, lmf2, tmem153, tmem112b, im:7150505, im:7152257, TMEM153, TMEM112B, Tmem153, AI451006, zgc:194766, MGC145062
Epitope
Middle Region
(2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Cow (Bovine), Xenopus laevis, Human
(6), (2), (2)
Host
Rabbit
(6), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7), (3), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN311257
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human LMF2
Sequence YVEPGTHGRLWTGAHRLFGAVEHLQLANSYGLFRRMTGLG GRPEVVLEGS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against LMF2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name LMF2
Background LMF2 belongs to the lipase maturation factor family. LMF2 is involved in the maturation of specific proteins in the endoplasmic reticulum. It may be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway.
Molecular Weight 77 kDa
Gene ID 91289
NCBI Accession NM_033200, NP_149977
UniProt Q9BU23
Research Area Signaling, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 682 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Lipase Maturation Factor 2 (LMF2) (Middle Region) antibody WB Suggested Anti-LMF2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Hela cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (6), (1)
Reactivities (6), (2), (2)
Applications (7), (3), (2), (2), (1)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top