Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311263

RFT1 Homolog (S. Cerevisiae) (RFT1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CDG1N, D930025H04, RGD1562654, GB14370
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311263
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RFT1 antibody: synthetic peptide directed towards the N terminal of human RFT1
Sequence GTQRDWSQTLNLLWLTVPLGVFWSLFLGWIWLQLLEVPDP NVVPHYATGV
Predicted Reactivity Dog : 100%, Human : 100%, Bovine : 92%, Chicken : 92%, Horse : 92%, Rabbit : 92%, Rat : 92%, Mouse : 84%
Characteristics This is a rabbit polyclonal antibody against RFT1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RFT1
Background N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of a��Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation.N-glycosylation of proteins follows a highly conserved pathway that begins with the synthesis of a Man(5)GlcNAc(2)-dolichylpyrophosphate (PP-Dol) intermediate on the cytoplasmic side of the endoplasmic reticulum (ER) membrane followed by the translocation of Man(5)GlcNAc (2)-PP-Dol to the luminal side of the ER membrane. RFT1 is the flippase enzyme that catalyzes this translocation (Helenius et al., 2002 [PubMed 11807558]).
Molecular Weight 60kDa
Gene ID 91869
NCBI Accession NP_443091, NM_052859
UniProt Q96AA3
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RFT1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Haeuptle, Pujol, Neupert et al.: "Human RFT1 deficiency leads to a disorder of N-linked glycosylation." in: American journal of human genetics, Vol. 82, Issue 3, pp. 600-6, 2008 (PubMed).

Alternatives for antigen "RFT1 Homolog (S. Cerevisiae) (RFT1)", type "Antibodies"
Hosts (6), (1)
Reactivities (6)
Applications (7), (3), (3), (2)
Epitopes (4), (2), (2), (1), (1)
Beacon