Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311541

Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PLEKHH1L, AI256725, E030001K05, mKIAA2028, RGD1304935, si:ch73-105b23.3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Fruit Fly (Drosophila melanogaster), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN311541
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PLEKHH2 antibody: synthetic peptide directed towards the C terminal of human PLEKHH2
Sequence WQLLALCVGLFLPHHPFLWLLRLHLKRNADSRTEFGKYAI YCQRCVERTQ
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Rabbit : 100%, Rat : 92%, Chicken : 86% Application WB, IHC
Characteristics This is a rabbit polyclonal antibody against PLEKHH2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PLEKHH2
Background PLEKHH2 contains 1 FERM domain, 1 MyTH4 domain and 2 PH domains. It is a Single-pass membrane protein. The exact function of PLEKHH2 remains unknown. Additional Information IHC Information: Human Prostate (formalin-fixed, paraffin-embedded) stained with PLEKHH2 antibody ARP53218_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen. IHC Information: Human Prostate (formalin-fixed, paraffin-embedded) stained with PLEKHH2 antibody ARP53218_P050 followed by biotinylated goat anti-rabbit IgG secondary antibody, alkaline phosphatase-streptavidin and chromogen.
Molecular Weight 168kDa
Gene ID 130271
NCBI Accession NP_742066, NM_172069
UniProt Q8IVE3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PLEKHH2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Mehrle, Rosenfelder, Schupp et al.: "The LIFEdb database in 2006." in: Nucleic acids research, Vol. 34, Issue Database issue, pp. D415-8, 2005 (PubMed).

Alternatives for antigen "Pleckstrin Homology Domain Containing, Family H (With MyTH4 Domain) Member 2 (PLEKHH2)", type "Antibodies"
Hosts (4)
Reactivities (3)
Applications (4), (3), (2), (1), (1)
Epitopes (3), (2)
Beacon