Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311588

Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
ADTB2, AP105B, AP2-BETA, CLAPB1, AI788979, 1300012O03Rik, fa16e07, zgc:55659, wu:fa16c06, wu:fa16e07, wu:fc18c08, AP-1beta1, AP-2beta, AP-beta1, AP1beta1, AP2beta2, BAD1, BAP, Beta-adaptin, CG12532, D ... show more
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311588
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-AP2B1 antibody: synthetic peptide directed towards the middle region of human AP2B1
Sequence SETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVT AKEVVLSEKP
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against AP2B1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name AP2B1
Background AP2B1is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. AP2B1 is found on the cytoplasmic face of coated vesicles in the plasma membrane.The protein encoded by this gene is one of two large chain components of the assembly protein complex 2, which serves to link clathrin to receptors in coated vesicles. The encoded protein is found on the cytoplasmic face of coated vesicles in the plasma membrane. Two transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 105kDa
Gene ID 163
NCBI Accession NP_001025177, NM_001030006
UniProt P63010
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-AP2B1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Schmid, Ford, Burtey et al.: "Role of the AP2 beta-appendage hub in recruiting partners for clathrin-coated vesicle assembly." in: PLoS biology, Vol. 4, Issue 9, pp. e262, 2006 (PubMed).

Alternatives for antigen "Adaptor-Related Protein Complex 2, beta 1 Subunit (AP2B1)", type "Antibodies"
Hosts (36), (3)
Reactivities (35), (16), (16), (16), (14), (12), (2), (2), (2)
Applications (30), (14), (10), (8), (5), (2)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon