Did you know that you can buy products from over 140 different suppliers from us?

Nucleoporin 155kDa (NUP155) (Middle Region) antibody

Details for Product No. ABIN311606
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms F10B6.25, F10B6_25, nucleoporin 155, DDBDRAFT_0189286, DDBDRAFT_0235243, DDB_0189286, DDB_0235243, D930027M19Rik, mKIAA0791, zgc:55435, N155
Epitope
Middle Region
(8), (6), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
(20), (8), (1), (1), (1), (1)
Host
Rabbit
(22)
Clonality
Polyclonal
Application
Western Blotting (WB)
(22), (8), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN311606
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NUP155
Sequence ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKE RMLRESLKEY
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Horse : 90 %, Pig : 90 %, Bovine : 80 %, Chicken : 80 %, Guinea pig : 80 %, Mouse : 80 %, African clawed frog : 70 %, Rat : 70 %, Zebrafish : 70 %
Characteristics This is a rabbit polyclonal antibody against NUP155. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NUP155
Background Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. The protein encoded by this gene does not contain the typical FG repeat sequences found in most vertebrate nucleoporins. Two protein isoforms are encoded by transcript variants of this gene.
Molecular Weight 147 kDa
Gene ID 9631
NCBI Accession NM_004298, NP_004289
UniProt O75694-2
Research Area Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1332 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nucleoporin 155kDa (NUP155) (Middle Region) antibody WB Suggested Anti-NUP155 Antibody Titration: 0.2-1 ug/ml
Positive Control: 721_B cell lysate
Background publications Hawryluk-Gara, Shibuya, Wozniak: "Vertebrate Nup53 interacts with the nuclear lamina and is required for the assembly of a Nup93-containing complex." in: Molecular biology of the cell, Vol. 16, Issue 5, pp. 2382-94, 2005 (PubMed).

Validation Images
back to top