Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311606

Nucleoporin 155kDa (NUP155) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms N155, mKIAA0791, D930027M19Rik, zgc:55435, F10B6.25, F10B6_25, nucleoporin 155, DDBDRAFT_0189286, DDBDRAFT_0235243, DDB_0189286, DDB_0235243
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311606
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NUP155 antibody: synthetic peptide directed towards the middle region of human NUP155
Sequence ISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKE RMLRESLKEY
Predicted Reactivity Human : 100%, Rabbit : 100%, Horse : 92%, Pig : 92%, Bovine : 85%, Chicken : 85%, Guinea pig : 85%, Mouse : 85%, African clawed frog : 78%, Rat : 78%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against NUP155. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NUP155
Background Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. NUP155 does not contain the typical FG repeat sequences found in most vertebrate nucleoporins.Nucleoporins are the main components of the nuclear pore complex (NPC) of eukaryotic cells. They are involved in the bidirectional trafficking of molecules, especially mRNAs and proteins, between the nucleus and the cytoplasm. The protein encoded by this gene does not contain the typical FG repeat sequences found in most vertebrate nucleoporins. Two protein isoforms are encoded by transcript variants of this gene.
Molecular Weight 147kDa
Gene ID 9631
NCBI Accession NP_004289, NM_004298
UniProt O75694-2
Research Area Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NUP155 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hawryluk-Gara, Shibuya, Wozniak: "Vertebrate Nup53 interacts with the nuclear lamina and is required for the assembly of a Nup93-containing complex." in: Molecular biology of the cell, Vol. 16, Issue 5, pp. 2382-94, 2005 (PubMed).

Alternatives for antigen "Nucleoporin 155kDa (NUP155)", type "Antibodies"
Hosts (23)
Reactivities (21), (7), (1), (1), (1), (1)
Applications (23), (9), (2), (1)
Epitopes (8), (8), (2), (1), (1)
Beacon