Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311630

Sperm Associated Antigen 11B (SPAG11B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms EDDM2B, EP2, EP2C, EP2D, HE2, HE2C, SPAG11, Ep2c/h, EG546038, Spag11c/h, SPAG11B
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311630
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SPAG11B antibody: synthetic peptide directed towards the N terminal of human SPAG11B
Sequence MRQRLLPSVTSLLLVALLFPGSSQARHVNHSATEALGELR ERAPGQGTNG
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SPAG11B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SPAG11B
Background SPAG11B is one of several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides.This gene encodes several androgen-dependent, epididymis-specific secretory proteins. The specific functions of these proteins have not been determined, but they are thought to be involved in sperm maturation. Some of the isoforms contain regions of similarity to beta-defensins, a family of antimicrobial peptides. The gene is located on chromosome 8p23 near the defensin gene cluster. Alternative splicing of this gene results in seven transcript variants encoding different isoforms. Two different N-terminal and five different C-terminal protein sequences are encoded by the splice variants. Two additional variants have been described, but their full length sequences have not been determined.
Molecular Weight 15kDa
Gene ID 10407
NCBI Accession NP_478108, NM_058201
UniProt Q08648-3
Research Area Immunology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SPAG11B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Avellar, Honda, Hamil et al.: "Differential expression and antibacterial activity of epididymis protein 2 isoforms in the male reproductive tract of human and rhesus monkey (Macaca mulatta)." in: Biology of reproduction, Vol. 71, Issue 5, pp. 1453-60, 2004 (PubMed).

Alternatives for antigen "Sperm Associated Antigen 11B (SPAG11B)", type "Antibodies"
Hosts (4)
Reactivities (2), (1)
Applications (4), (2)
Epitopes (2), (1)
Beacon