Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311714

GLE1 RNA Export Mediator Homolog (Yeast) (GLE1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms LCCS, GLE1L, LCCS1, hGLE1, 4933405K21Rik, AA553313, Gle1l, Dmel\\CG14749, GLE1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311714
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GLE1 antibody: synthetic peptide directed towards the N terminal of human GLE1
Sequence LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQ LSQQLDASEQ
Predicted Reactivity Horse : 100%, Human : 100%, Bovine : 92%, Dog : 92%, Mouse : 92%, Rat : 92%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against GLE1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name GLE1
Background GLE1 is a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm.This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 75kDa
Gene ID 2733
NCBI Accession NP_001490, NM_001499
UniProt Q53GS7
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GLE1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nousiainen, Kestilä, Pakkasjärvi et al.: "Mutations in mRNA export mediator GLE1 result in a fetal motoneuron disease." in: Nature genetics, Vol. 40, Issue 2, pp. 155-7, 2008 (PubMed).

Alternatives for antigen "GLE1 RNA Export Mediator Homolog (Yeast) (GLE1)", type "Antibodies"
Hosts (36), (3)
Reactivities (37), (26), (26), (12), (12), (12)
Applications (29), (24), (13), (10), (10), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (4), (2), (2), (2), (1), (1), (1)
Beacon