GLE1 RNA Export Mediator Homolog (Yeast) (GLE1) (N-Term) antibody

Details for Product No. ABIN311714
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms LCCS, GLE1L, LCCS1, hGLE1, 4933405K21Rik, AA553313, Gle1l, Dmel\\CG14749, GLE1
Epitope
N-Term
(9), (4), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
(39), (28), (28), (12), (12), (12)
Host
Rabbit
(38), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(31), (25), (13), (13), (10), (4), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN311714
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GLE1
Sequence LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQ LSQQLDASEQ
Predicted Reactivity Horse : 100 %, Human : 100 %, Bovine : 90 %, Dog : 90 %, Mouse : 90 %, Rat : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against GLE1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name GLE1
Background GLE1 is a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm.This gene encodes a predicted 75-kDa polypeptide with high sequence and structure homology to yeast Gle1p, which is nuclear protein with a leucine-rich nuclear export sequence essential for poly(A)+RNA export. Inhibition of human GLE1L by microinjection of antibodies against GLE1L in HeLa cells resulted in inhibition of poly(A)+RNA export. Immunoflourescence studies show that GLE1L is localized at the nuclear pore complexes. This localization suggests that GLE1L may act at a terminal step in the export of mature RNA messages to the cytoplasm. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 75 kDa
Gene ID 2733
NCBI Accession NM_001499, NP_001490
UniProt Q53GS7
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 659 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-GLE1 RNA Export Mediator Homolog (Yeast) (GLE1) (N-Term) antibody WB Suggested Anti-GLE1 Antibody Titration: 0.2-1 ug/ml
Positive Control: Human Placenta
Background publications Nousiainen, Kestilä, Pakkasjärvi et al.: "Mutations in mRNA export mediator GLE1 result in a fetal motoneuron disease." in: Nature genetics, Vol. 40, Issue 2, pp. 155-7, 2008 (PubMed).

Hosts (38), (3)
Reactivities (39), (28), (28), (12), (12), (12)
Applications (31), (25), (13), (13), (10), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (4), (3), (2), (1), (1), (1), (1), (1)
back to top