Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN311722

Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MNSFbeta, FAU1, Fub1, Fubi, RPS30, S30, asr1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Xenopus laevis, Dog (Canine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN311722
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FAU antibody: synthetic peptide directed towards the middle region of human FAU
Sequence VRGQTPKVAKQEKKKKKTGRAKRRMQYNRRFVNVVPTFGK KKGPNANS
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against FAU. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name FAU
Background FAU is a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome.This gene is the cellular homolog of the fox sequence in the Finkel-Biskis-Reilly murine sarcoma virus (FBR-MuSV). It encodes a fusion protein consisting of the ubiquitin-like protein fubi at the N terminus and ribosomal protein S30 at the C terminus. It has been proposed that the fusion protein is post-translationally processed to generate free fubi and free ribosomal protein S30. Fubi is a member of the ubiquitin family, and ribosomal protein S30 belongs to the S30E family of ribosomal proteins. Whereas the function of fubi is currently unknown, ribosomal protein S30 is a component of the 40S subunit of the cytoplasmic ribosome. Pseudogenes derived from this gene are present in the genome. Similar to ribosomal protein S30, ribosomal proteins S27a and L40 are synthesized as fusion proteins with ubiquitin.
Molecular Weight 14kDa
Gene ID 2197
NCBI Accession NP_001988, NM_001997
UniProt P62861
Research Area Proteolysis / Ubiquitin, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FAU antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Yu, Ji, Doudna et al.: "Mass spectrometric analysis of the human 40S ribosomal subunit: native and HCV IRES-bound complexes." in: Protein science : a publication of the Protein Society, Vol. 14, Issue 6, pp. 1438-46, 2005 (PubMed).

Alternatives for antigen "Finkel-Biskis-Reilly Murine Sarcoma Virus (FBR-MuSV) Ubiquitously Expressed (FAU)", type "Antibodies"
Hosts (12), (2)
Reactivities (13), (2)
Applications (14), (8), (7), (3), (1), (1)
Epitopes (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon