IL22RA2 antibody (AA 33-60)

Catalog No. ABIN342774

Product Details anti-IL22RA2 Antibody

Target: IL22RA2 (Interleukin 22 Receptor, alpha 2 (IL22RA2))

Binding Specificity: AA 33-60

Reactivity: Human, Monkey

Host: Goat

Clonality: Polyclonal

Conjugate: This IL22RA2 antibody is un-conjugated

Application: ELISA

Specificity: This antibody recognizes the N-terminus region of human interleukin-22 receptor alpha-2 chain precursor (IL-22R-alpha-2) which is also known as IL-22-binding protein (IL22BP), cytokine receptor family class II member 10 (CRF2-10), and cytokine receptor family type 2, soluble 1 (CRF2-S1). This antibody is likely to recognize rat and mouse IL-22 RA2 protein due to sequence similarity. The peptide sequence is <50 % identical to other sequences in GenBank.

Predicted Reactivity: Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%) Gibbon (96%) Marmoset (89%) Dog (82%).

Purification: Immunoaffinity purified

Immunogen: Synthetic peptide RVQFQSRNFHNILQWQPGRALTGNSSVY-C corresponding to 33-60 residues of N-terminus of human IL-22R-alpha-2 protein with cysteine added for conjugation to a carrier protein. Percent identity by BLAST analysis: Human, Gorilla, Monkey (100%), Gibbon (96%), Marmoset (89%), Dog (82%).

Type of Immunogen: Synthetic peptide

Application Details

Application Notes: Approved: ELISA (1:50000)

Usage: ELISA: Peptide-based assay to confirm the ability of the antibody to recognize the immunogenic peptide.

Not recommended for: IHC-P

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: Lot specific

Buffer: 10  mM KHPO4, 140  mM NaCl, BSA, 0.1 % sodium azide

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Aliquot to Avoid freeze/thaw cycles.

Storage: -20 °C

Storage Comment: Store at -20°C. Aliquot to avoid freeze/thaw cycles.

Target Details for IL22RA2

Target: IL22RA2 (Interleukin 22 Receptor, alpha 2 (IL22RA2))

Alternative Name: IL-22BP / IL22RA2 (IL22RA2 Products)

Synonyms: CRF2-10 antibody, CRF2-S1 antibody, CRF2X antibody, IL-22BP antibody, IL-22R-alpha-2 antibody, IL-22RA2 antibody, ZCYTOR16 antibody, CRF2-s1 antibody, Il-22bp antibody, Crf2-s1 antibody, interleukin 22 receptor subunit alpha 2 antibody, interleukin 22 receptor, alpha 2 antibody, IL22RA2 antibody, Il22ra2 antibody

Background: Name/Gene ID: IL22RA2

Synonyms: IL22RA2, Class II cytokine receptor, IL-22BP, IL-22RA2, IL-22R-alpha-2, Interleukin 22-binding protein, Interleukin-22-binding protein, CRF2-10, CRF2-S1, CRF2X, IL-22 receptor subunit alpha-2, IL22BP, ZcytoR16

Gene ID: 116379

UniProt: Q969J5