Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404805

SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN404805
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIN3A antibody: synthetic peptide directed towards the N terminal of human SIN3A
Sequence KRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVY EAVSETMQSA
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Guinea pig : 92%, Rabbit : 92%, Chicken : 76%
Characteristics This is a rabbit polyclonal antibody against SIN3A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SIN3A
Background SIN3A is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.
Molecular Weight 145kDa
Gene ID 25942
NCBI Accession NP_056292, NM_015477
UniProt Q96ST3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIN3A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhao, Jankovic, Gural et al.: "Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity." in: Genes & development, Vol. 22, Issue 5, pp. 640-53, 2008 (PubMed).

Alternatives for antigen "SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A)", type "Antibodies"
Hosts (24), (1)
Reactivities (20), (10), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (22), (10), (7), (5), (3), (3), (1), (1)
Epitopes (4), (3), (2), (2), (1), (1), (1), (1), (1)
Beacon