Did you know that you can buy products from over 140 different suppliers from us?

SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) (N-Term) antibody

Details for Product No. ABIN404805
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(9), (7), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human, Chicken
(18), (15), (3)
Host
Rabbit
(28), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(27), (10), (9), (8), (4), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN404805
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SIN3A
Sequence KRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVY EAVSETMQSA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, Rabbit : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against SIN3A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SIN3A
Background SIN3A is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.
Molecular Weight 145 kDa
Gene ID 25942
NCBI Accession NM_015477, NP_056292
UniProt Q96ST3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1273 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) (N-Term) antibody WB Suggested Anti-SIN3A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
anti-SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) (N-Term) antibody (2) anti-SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) (N-Term) antibody (Image 2)
Background publications Zhao, Jankovic, Gural et al.: "Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity." in: Genes & development, Vol. 22, Issue 5, pp. 640-53, 2008 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404805
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top