Did you know that you can buy products from over 140 different suppliers from us?

SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) (N-Term) antibody

Details for Product No. ABIN404805
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(9), (7), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human, Chicken
(18), (15), (3)
Host
Rabbit
(28), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(27), (10), (9), (8), (4), (4), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN404805
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SIN3A
Sequence KRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVY EAVSETMQSA
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Guinea pig : 90 %, Rabbit : 90 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against SIN3A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SIN3A
Background SIN3A is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.The protein encoded by this gene is a transcriptional regulatory protein. It contains paired amphipathic helix (PAH) domains, which are important for protein-protein interactions and may mediate repression by the Mad-Max complex.
Molecular Weight 145 kDa
Gene ID 25942
NCBI Accession NM_015477, NP_056292
UniProt Q96ST3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1273 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) (N-Term) antibody WB Suggested Anti-SIN3A Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Hela cell lysate
anti-SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) (N-Term) antibody (2) anti-SIN3 Transcription Regulator Homolog A (Yeast) (SIN3A) (N-Term) antibody (Image 2)
Background publications Zhao, Jankovic, Gural et al.: "Methylation of RUNX1 by PRMT1 abrogates SIN3A binding and potentiates its transcriptional activity." in: Genes & development, Vol. 22, Issue 5, pp. 640-53, 2008 (PubMed).

Hosts (28), (1)
Reactivities (18), (15), (3)
Applications (27), (10), (9), (8), (4), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (3), (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404805
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top