Did you know that you can buy products from over 140 different suppliers from us?

Neuronal PAS Domain Protein 1 (NPAS1) (Middle Region) antibody

Details for Product No. ABIN404821
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MOP5, PASD5, bHLHe11, si:dkeyp-13e2.1
Epitope
Middle Region
(6), (2), (1), (1)
Reactivity
Human
(26), (19), (17), (12), (12), (12)
Host
Rabbit
(28)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(19), (10), (10), (5), (4)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN404821
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NPAS1
Sequence SSSSSSSLADTPEIEASLTKVPPSSLVQERSFFVRMKSTL TKRGLHVKAS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against NPAS1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NPAS1
Background NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development. The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.
Molecular Weight 63 kDa
Gene ID 4861
NCBI Accession NM_002517, NP_002508
UniProt Q99742
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 590 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Neuronal PAS Domain Protein 1 (NPAS1) (Middle Region) antibody WB Suggested Anti-NPAS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Hogenesch, Chan, Jackiw et al.: "Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway." in: The Journal of biological chemistry, Vol. 272, Issue 13, pp. 8581-93, 1997 (PubMed).

Hosts (28)
Reactivities (26), (19), (17), (12), (12), (12)
Applications (19), (10), (10), (5), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404821
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top