Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404821

Neuronal PAS Domain Protein 1 (NPAS1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms MOP5, PASD5, bHLHe11, si:dkeyp-13e2.1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404821
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NPAS1 antibody: synthetic peptide directed towards the middle region of human NPAS1
Sequence SSSSSSSLADTPEIEASLTKVPPSSLVQERSFFVRMKSTL TKRGLHVKAS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against NPAS1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NPAS1
Background NPAS1 is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development. The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. Studies of a related mouse gene suggest that it functions in neurons. The exact function of this gene is unclear, but it may play protective or modulatory roles during late embryogenesis and postnatal development.
Molecular Weight 63kDa
Gene ID 4861
NCBI Accession NP_002508, NM_002517
UniProt Q99742
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NPAS1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Hogenesch, Chan, Jackiw et al.: "Characterization of a subset of the basic-helix-loop-helix-PAS superfamily that interacts with components of the dioxin signaling pathway." in: The Journal of biological chemistry, Vol. 272, Issue 13, pp. 8581-93, 1997 (PubMed).

Alternatives for antigen "Neuronal PAS Domain Protein 1 (NPAS1)", type "Antibodies"
Hosts (26)
Reactivities (24), (18), (16), (12), (12), (12)
Applications (17), (10), (10), (4), (4)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (2), (1)
Beacon