Did you know that you can buy products from over 140 different suppliers from us?

Chromatin Accessibility Complex 1 (CHRAC1) (N-Term) antibody

Details for Product No. ABIN404848
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CHARC1, CHARC15, CHRAC-1, CHRAC-15, CHRAC15, YCL1, 2410152E03Rik, 2810406L04Rik, chrac1, CHRAC1
Epitope
N-Term
(3), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(23), (7), (3), (1), (1), (1)
Host
Rabbit
(12), (11)
Clonality
Polyclonal
Application
Western Blotting (WB)
(17), (12), (6), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN404848
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human CHRAC1
Sequence SINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYS DLANTAQQSE
Predicted Reactivity Human : 100 %, Bovine : 90 %, Horse : 90 %, Mouse : 80 %, Pig : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against CHRAC1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CHRAC1
Background CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
Molecular Weight 15 kDa
Gene ID 54108
NCBI Accession NM_017444, NP_059140
UniProt Q9NRG0
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 131 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Collins, Poot, Kukimoto et al.: "An ACF1-ISWI chromatin-remodeling complex is required for DNA replication through heterochromatin." in: Nature genetics, Vol. 32, Issue 4, pp. 627-32, 2002 (PubMed).

Hosts (12), (11)
Reactivities (23), (7), (3), (1), (1), (1)
Applications (17), (12), (6), (3), (2), (1)
Epitopes (3), (2), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404848
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top