Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404848

Chromatin Accessibility Complex 1 (CHRAC1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CHARC1, CHARC15, CHRAC-1, CHRAC-15, CHRAC15, YCL1, 2410152E03Rik, 2810406L04Rik, chrac1, CHRAC1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404848
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CHRAC1 antibody: synthetic peptide directed towards the N terminal of human CHRAC1
Sequence SINQEALVLTAKATELFVQCLATYSYRHGSGKEKKVLTYS DLANTAQQSE
Predicted Reactivity Human : 100%, Bovine : 92%, Horse : 92%, Mouse : 84%, Pig : 84%, Rat : 84%
Characteristics This is a rabbit polyclonal antibody against CHRAC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CHRAC1
Background CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging. CHRAC1 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
Molecular Weight 15kDa
Gene ID 54108
NCBI Accession NP_059140, NM_017444
UniProt Q9NRG0
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CHRAC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Collins, Poot, Kukimoto et al.: "An ACF1-ISWI chromatin-remodeling complex is required for DNA replication through heterochromatin." in: Nature genetics, Vol. 32, Issue 4, pp. 627-32, 2002 (PubMed).

Alternatives for antigen "Chromatin Accessibility Complex 1 (CHRAC1)", type "Antibodies"
Hosts (12), (11)
Reactivities (23), (8), (3), (1), (1), (1)
Applications (17), (16), (6), (3), (2), (1)
Epitopes (3), (2), (2), (1), (1), (1)
Beacon