Did you know that you can buy products from over 140 different suppliers from us?

Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16) (Middle Region) antibody

Details for Product No. ABIN404894
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ARTD15, LRRGT00109, RGD1306243, C15orf30, pART15, BC055447, C79952, PARP-16, PARP16, zgc:77744
Epitope
Middle Region
(8), (7), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(31), (13), (13), (13), (12)
Host
Rabbit
(29), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(20), (13), (11), (10), (8), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN404894
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PARP16
Sequence PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHW FTVMISLYLL
Predicted Reactivity Dog : 85 %, Horse : 85 %, Mouse : 85 %, Rabbit : 85 %, Rat : 85 %, Guinea pig : 75 %
Characteristics This is a rabbit polyclonal antibody against PARP16. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PARP16
Background Poly(ADP-ribosyl)ation is an immediate DNA-damage-dependent post-translational modification of histones and other nuclear proteins that contributes to the survival of injured proliferating cells. PARP16 is a member of poly(ADP-ribose) polymerases (PARPs) family that is encoded by different genes and displaying a conserved catalytic domain in which PARP-1 (113 kDa), the founding member, and PARP-2 (62 kDa) are so far the sole enzymes whose catalytic activity has been shown to be immediately stimulated by DNA strand breaks. A large repertoire of sequences encoding novel PARPs now extends considerably the field of poly(ADP-ribosyl)ation reactions to various aspects of the cell biology including cell proliferation and cell death. Some of these new members interact with each other, share common partners and common subcellular localizations suggesting possible fine tuning in the regulation of this post-translational modification of proteins.
Molecular Weight 36 kDa
Gene ID 54956
NCBI Accession NM_017851, NP_060321
UniProt Q8N5Y8-3
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 323 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly (ADP-Ribose) Polymerase Family, Member 16 (PARP16) (Middle Region) antibody WB Suggested Anti-PARP16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Amé, Spenlehauer, de Murcia: "The PARP superfamily." in: BioEssays : news and reviews in molecular, cellular and developmental biology, Vol. 26, Issue 8, pp. 882-93, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN404894
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top