Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN404910

Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DRK1, KV2.1, h-DRK1, Shab, DRK1PC, Kcr1-1, Kv2.1, Kcnb1, KCNB1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Cow (Bovine), Dog (Canine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN404910
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KCNB1 antibody: synthetic peptide directed towards the middle region of human KCNB1
Sequence YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEK NHFESSPLPT
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Pig : 92%, Guinea pig : 85%, Horse : 85%, Rat : 85%, Mouse : 78%
Characteristics This is a rabbit polyclonal antibody against KCNB1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KCNB1
Background Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shab-related subfamily. This member is a delayed rectifier potassium channel and its activity is modulated by some other family members.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shab-related subfamily. This member is a delayed rectifier potassium channel and its activity is modulated by some other family members.
Molecular Weight 96kDa
Gene ID 3745
NCBI Accession NP_004966, NM_004975
UniProt Q14721
Research Area Neurology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KCNB1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Adair, Nunn, Lewis et al.: "Single particle image reconstruction of the human recombinant Kv2.1 channel." in: Biophysical journal, Vol. 94, Issue 6, pp. 2106-14, 2008 (PubMed).

Alternatives for antigen "Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1)", type "Antibodies"
Hosts (65), (18), (4), (1)
Reactivities (79), (71), (69), (37), (37), (26), (12), (3)
Applications (49), (36), (30), (25), (13), (10), (9), (8), (6), (2)
Conjugates (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Epitopes (18), (13), (12), (4), (4), (4), (3), (2), (2), (1), (1), (1), (1)
Beacon