Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1) antibody

Antigen

Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1)
Synonyms DRK1, KV2.1, h-DRK1, Kcnb1, KCNB1, Shab
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Rat (Rattus), Mouse (Murine), Dog (Canine), Pig (Porcine)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
1 reference available
Catalog no. ABIN404910
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name KCNB1
Gene ID KCNB1
UniProt Q14721
Immunogen The immunogen for anti-KCNB1 antibody: synthetic peptide directed towards the middle region of human KCNB1
Sequence YIDADTDDEGQLLYSVDSSPPKSLPGSTSPKFSTGTRSEK NHFESSPLPT
Cross-Reactivity Cow (Bovine), Dog (Canine), Human, Mouse (Murine), Pig (Porcine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-KCNB1 antibody concentration is 1 mg/ml.
Description Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shab-related subfamily. This member is a delayed rectifier potassium channel and its activity is modulated by some other family members.Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. Four sequence-related potassium channel genes - shaker, shaw, shab, and shal - have been identified in Drosophila, and each has been shown to have human homolog(s). This gene encodes a member of the potassium channel, voltage-gated, shab-related subfamily. This member is a delayed rectifier potassium channel and its activity is modulated by some other family members. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Characteristics Antigen Size: 858 amino acids
Molecular Weight 96kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-KCNB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Research Area Neurology
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Adair, Nunn, Lewis et al.: "Single particle image reconstruction of the human recombinant Kv2.1 channel." in: Biophysical journal, Vol. 94, Issue 6, pp. 2106-14, 2008 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Potassium Voltage-Gated Channel, Shab-Related Subfamily, Member 1 (KCNB1)", type "Antibodies"
Hosts Rabbit (54), Mouse (14), Goat (2)
Reactivities Human (60), Mouse (Murine) (54), Rat (Rattus) (54), Cow (Bovine) (24), Dog (Canine) (24), Pig (Porcine) (24), Horse (Equine) (5), Monkey (3)
Applications Immunofluorescence (IF) (41), Western Blotting (WB) (29), Immunohistochemistry (IHC) (20), ELISA (13), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (6), Immunoprecipitation (IP) (6), Immunostaining (ISt) (6), Immunocytochemistry (ICC) (4), Immunoelectron Microscopy (IEM) (2)
Conjugates Alexa Fluor 350 (3), Alexa Fluor 488 (3), Alexa Fluor 555 (3), Alexa Fluor 647 (3), Biotin (2), Cy3 (2), Cy5 (2), Cy5.5 (2), Cy7 (2), FITC (2), Gold (2), HRP (2), PE (2), PE,Cy5.5 (2), Alexa Flour 488 (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1), PE-Cy3 (1), PE-Cy5 (1), PE-Cy5.5 (1), PE-Cy7 (1), Un-conjugated (1)
Epitopes pSer805 (19), pTyr128 (4), Internal Region (3), AA 509-853 (2), C-Term (2), External Domain (2), AA 11-229 (1), AA 211-229 (1), Extracellular (1), pSer567 (1), pTyr762 (1)