Chromosome 16 Open Reading Frame 80 (C16orf80) (Middle Region) antibody

Details for Product No. ABIN404932
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GTL3, EVORF, fSAP23, C16orf80, C20H16orf80
Epitope
Middle Region
(3), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human, Chicken
(8), (4), (3), (3), (3), (3), (3), (3), (1)
Host
Rabbit
(7), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(8), (1), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN404932
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human C16orf80
Sequence IKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQS TTRVKPFICT
Predicted Reactivity Guinea pig : 100 %, Horse : 100 %, Rabbit : 100 %
Characteristics This is a rabbit polyclonal antibody against C16orf80. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name C16orf80
Background The exact function of C16orf80 remains unknown.
Molecular Weight 23 kDa
Gene ID 29105
NCBI Accession NM_013242, NP_037374
UniProt Q9Y6A4
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 193 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 16 Open Reading Frame 80 (C16orf80) (Middle Region) antibody WB Suggested Anti-C16orf80 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Jin, Smith, Stark et al.: "Proteomic, functional, and domain-based analysis of in vivo 14-3-3 binding proteins involved in cytoskeletal regulation and cellular organization." in: Current biology : CB, Vol. 14, Issue 16, pp. 1436-50, 2004 (PubMed).

Hosts (7), (1)
Reactivities (8), (4), (3), (3), (3), (3), (3), (3), (1)
Applications (8), (1), (1), (1), (1)
Epitopes (3), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top