Potassium Voltage-Gated Channel, Delayed-Rectifier, Subfamily S, Member 1 (KCNS1) (N-Term) antibody

Details for Product No. ABIN404980
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Kv9.1, KV9.1
Epitope
N-Term
(3), (1)
Reactivity
Human
(5)
Host
Rabbit
(5), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(5), (1)
Pubmed 1 reference available
Catalog no. ABIN404980
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KCNS1
Sequence LMLLVRGTHYENLRSKVVLPTPLGGRSTETFVSEFPGPDT GIRWRRSDEA
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against KCNS1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCNS1
Background Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. KCNS1 is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins.Voltage-gated potassium channels form the largest and most diversified class of ion channels and are present in both excitable and nonexcitable cells. Their main functions are associated with the regulation of the resting membrane potential and the control of the shape and frequency of action potentials. The alpha subunits are of 2 types: those that are functional by themselves and those that are electrically silent but capable of modulating the activity of specific functional alpha subunits. The protein encoded by this gene is not functional by itself but can form heteromultimers with member 1 and with member 2 (and possibly other members) of the Shab-related subfamily of potassium voltage-gated channel proteins. This gene belongs to the S subfamily of the potassium channel family.
Molecular Weight 58 kDa
Gene ID 3787
NCBI Accession NM_002251, NP_002242
UniProt Q96KK3
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 526 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Voltage-Gated Channel, Delayed-Rectifier, Subfamily S, Member 1 (KCNS1) (N-Term) antibody WB Suggested Anti-KCNS1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Background publications Gutman, Chandy, Grissmer et al.: "International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 473-508, 2005 (PubMed).

Hosts (5), (1)
Reactivities (5)
Applications (5), (1)
Epitopes (3), (1)
back to top