Potassium Inwardly-Rectifying Channel, Subfamily J, Member 16 (KCNJ16) (Middle Region) antibody

Details for Product No. ABIN404987
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BIR9, KIR5.1, Kir5.1, AI132396, 6430410F18Rik, kcnj16-A, KCNJ16
Epitope
Middle Region
(14), (5), (4), (1), (1), (1), (1)
Reactivity
Dog (Canine), Human
(43), (43), (40), (29), (12), (12)
Host
Rabbit
(49), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(27), (24), (21), (15), (11), (11), (8), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN404987
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human KCNJ16
Sequence RESCTSDTKARRRSFSAVAIVSSCENPEETTTSATHEYRE TPYQKALLTL
Predicted Reactivity Human : 100 %, Dog : 80 %, Rabbit : 80 %, Pig : 70 %
Characteristics This is a rabbit polyclonal antibody against KCNJ16. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCNJ16
Background Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. KCNJ16 is an integral membrane protein and inward-rectifier type potassium channel. KCNJ16, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, can form heterodimers with two other inward-rectifier type potassium channels. It may be involved in the regulation of fluid and pH balance.Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, can form heterodimers with two other inward-rectifier type potassium channels. It may be involved in the regulation of fluid and pH balance. Three transcript variants encoding the same protein have been found for this gene.
Molecular Weight 48 kDa
Gene ID 3773
NCBI Accession NM_018658, NP_061128
UniProt Q9NPI9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 418 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Inwardly-Rectifying Channel, Subfamily J, Member 16 (KCNJ16) (Middle Region) antibody WB Suggested Anti-KCNJ16 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: 721_B cell lysate
Background publications Ji, Foo, ORoak et al.: "Rare independent mutations in renal salt handling genes contribute to blood pressure variation." in: Nature genetics, Vol. 40, Issue 5, pp. 592-9, 2008 (PubMed).

Hosts (49), (2)
Reactivities (43), (43), (40), (29), (12), (12)
Applications (27), (24), (21), (15), (11), (11), (8), (3), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Epitopes (14), (5), (4), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top