Potassium Channel Tetramerisation Domain Containing 7 (KCTD7) (N-Term) antibody

Details for Product No. ABIN404994
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 4932409E18, 9430010P06Rik, CLN14, EPM3
Epitope
N-Term
(12), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(15), (12), (12), (12), (12), (12), (12)
Host
Rabbit
(15), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (7), (3), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN404994
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KCTD7
Sequence VVVTGREPDSRRQDGAMSSSDAEDDFLEPATPTATQAGHA LPLLPQEFPE
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Chicken : 90 %
Characteristics This is a rabbit polyclonal antibody against KCTD7. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCTD7
Background The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels (see KCNA1, MIM 176260). KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain.The KCTD gene family, including KCTD7, encode predicted proteins that contain N-terminal domain that is homologous to the T1 domain in voltage-gated potassium channels (see KCNA1, MIM 176260). KCTD7 displays a primary sequence and hydropathy profile indicating intracytoplasmic localization. EST database analysis showed that KCTD7 is expressed in human and mouse brain (Van Bogaert et al., 2007 [PubMed 17455289]).
Molecular Weight 33 kDa
Gene ID 154881
NCBI Accession NM_153033, NP_694578
UniProt Q96MP8
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 289 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Van Bogaert, Azizieh, Désir et al.: "Mutation of a potassium channel-related gene in progressive myoclonic epilepsy." in: Annals of neurology, Vol. 61, Issue 6, pp. 579-86, 2007 (PubMed).

Hosts (15), (1)
Reactivities (15), (12), (12), (12), (12), (12), (12)
Applications (10), (7), (3), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (12), (1), (1), (1)
back to top