Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) (N-Term) antibody

Details for Product No. ABIN404998
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms K13, KCNG, KV6.1, kH2, AW536275, OTTMUSG00000016048, Kh2, Kv6.1, kcng1, MGC122787
Epitope
N-Term
(5), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Human, Chicken
(18), (14), (14), (13), (13), (12)
Host
Rabbit
(21)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (10), (4), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN404998
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human KCNG1
Sequence YDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSF QEELLYWGIA
Predicted Reactivity Bovine : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Chicken : 90 %, Dog : 90 %, Horse : 90 %
Characteristics This is a rabbit polyclonal antibody against KCNG1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KCNG1
Background Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. KCNG1 is a member of the potassium channel, voltage-gated, subfamily G. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Alternative splicing results in at least two transcript variants encoding distinct isoforms. Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This gene is abundantly expressed in skeletal muscle. Multiple alternatively spliced transcript variants have been found in normal and cancerous tissues.
Molecular Weight 58 kDa
Gene ID 3755
NCBI Accession NM_002237, NP_002228
UniProt Q9UIX4
Research Area Neurology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 513 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Potassium Voltage-Gated Channel, Subfamily G, Member 1 (KCNG1) (N-Term) antibody WB Suggested Anti-KCNG1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: MCF7 cell lysate
Background publications Gutman, Chandy, Grissmer et al.: "International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels." in: Pharmacological reviews, Vol. 57, Issue 4, pp. 473-508, 2005 (PubMed).

Hosts (21)
Reactivities (18), (14), (14), (13), (13), (12)
Applications (12), (10), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top