Did you know that you can buy products from over 140 different suppliers from us?

Zinc Finger Protein 45 (ZNF45) (Middle Region) antibody

Details for Product No. ABIN405008
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KOX5, ZNF13, ZNF235
Epitope
Middle Region
(2), (1)
Reactivity
Cow (Bovine), Human
(4)
Host
Rabbit
(4)
Clonality
Polyclonal
Application
Western Blotting (WB)
(4)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN405008
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF45
Sequence RVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDF PSSEDSHRKT
Predicted Reactivity Human : 100 %, Pig : 80 %, Bovine : 70 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against ZNF45. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF45
Background ZNF45 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 18 C2H2-type zinc fingers and 1 KRAB domain. ZNF45 may be involved in transcriptional regulation.
Molecular Weight 78 kDa
Gene ID 7596
NCBI Accession NM_003425, NP_003416
UniProt Q02386
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 682 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405008
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top