Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405008

Zinc Finger Protein 45 (ZNF45) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KOX5, ZNF13, ZNF235
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405008
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF45 antibody: synthetic peptide directed towards the middle region of human ZNF45
Sequence RVHTGEKPYKCEECGKGFSWSSSLIIHQRVHADDEGDKDF PSSEDSHRKT
Predicted Reactivity Human : 100%, Pig : 85%, Bovine : 78%, Horse : 76%
Characteristics This is a rabbit polyclonal antibody against ZNF45. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF45
Background ZNF45 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 18 C2H2-type zinc fingers and 1 KRAB domain. ZNF45 may be involved in transcriptional regulation.
Molecular Weight 78kDa
Gene ID 7596
NCBI Accession NP_003416, NM_003425
UniProt Q02386
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF45 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Grimwood, Gordon, Olsen et al.: "The DNA sequence and biology of human chromosome 19." in: Nature, Vol. 428, Issue 6982, pp. 529-35, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 45 (ZNF45)", type "Antibodies"
Hosts (5)
Reactivities (5)
Applications (5), (2)
Epitopes (2), (1)
Beacon