Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405009

Zinc Finger Protein 74 (ZNF74) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms COS52, ZFP520, ZNF520, hZNF7, 2810054M15Rik, KRAB8, Zfp66, Znf569, mszf21, mszf77, ZNF74
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405009
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF74 antibody: synthetic peptide directed towards the middle region of human ZNF74
Sequence RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGK AFRQSSSLTL
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF74. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF74
Background ZNF74 contains 1 KRAB domain. The exact function of ZNF74 is not known.
Molecular Weight 72kDa
Gene ID 7625
NCBI Accession NP_003417, NM_003426
UniProt Q6PJP1
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF74 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein 74 (ZNF74)", type "Antibodies"
Hosts (4), (2)
Reactivities (6), (1)
Applications (5), (2), (2), (1), (1)
Epitopes (2), (1), (1)
Beacon