Zinc Finger Protein 74 (ZNF74) (Middle Region) antibody

Details for Product No. ABIN405009
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms COS52, ZFP520, ZNF520, hZNF7, 2810054M15Rik, KRAB8, Zfp66, Znf569, mszf21, mszf77, ZNF74
Epitope
Middle Region
(2), (1), (1)
Reactivity
Human
(7), (2), (1)
Host
Rabbit
(5), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(6), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405009
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ZNF74
Sequence RLCAGENASTPSEPEKFPQVRRQRGAGAGEGEFVCGECGK AFRQSSSLTL
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF74. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF74
Background ZNF74 contains 1 KRAB domain. The exact function of ZNF74 is not known.
Molecular Weight 72 kDa
Gene ID 7625
NCBI Accession NM_003426, NP_003417
UniProt Q6PJP1
Research Area Chromatin and Nuclear Signaling, Chromatin Binding Proteins, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 644 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Zinc Finger Protein 74 (ZNF74) (Middle Region) antibody WB Suggested Anti-ZNF74 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: 293T cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (5), (2)
Reactivities (7), (2), (1)
Applications (6), (2), (2), (1)
Epitopes (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top