Sex Comb On Midleg-Like 1 (Drosophila) (SCML1) (N-Term) antibody

Details for Product No. ABIN405020
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
(5), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Human
(26)
Host
Rabbit
(16), (10)
Clonality
Polyclonal
Application
Western Blotting (WB)
(22), (8), (5), (4), (3), (3), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405020
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SCML1
Sequence PSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYY ASDGATYGSS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against SCML1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SCML1
Background The function of SCML1 remains unknown.
Molecular Weight 23 kDa
Gene ID 6322
NCBI Accession NM_001037536, NP_001032625
UniProt Q9UN30
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 208 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sex Comb On Midleg-Like 1 (Drosophila) (SCML1) (N-Term) antibody WB Suggested Anti-SCML1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Hela cell lysate
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome...." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Hosts (16), (10)
Reactivities (26)
Applications (22), (8), (5), (4), (3), (3), (2), (1)
Epitopes (5), (3), (2), (2), (2), (1), (1), (1)
back to top