Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405024

TAR DNA Binding Protein (TARDBP) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALS10, TDP-43, Tdp43, C85084, 1190002A23Rik, wu:fb77f02, wu:fc52g10, TARDBP, TDP43, DKFZp459I2127, tardbp
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405024
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TARDBP antibody: synthetic peptide directed towards the middle region of human TARDBP
Sequence GISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGN SRGGGAGLGN
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against TARDBP. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TARDBP
Background HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Molecular Weight 45kDa
Gene ID 23435
NCBI Accession NP_031401, NM_007375
UniProt Q13148
Research Area Chromatin and Nuclear Signaling, Transcription Factors, DNA/RNA, Hormones, Cytokines
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TARDBP antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kabashi, Valdmanis, Dion et al.: "TARDBP mutations in individuals with sporadic and familial amyotrophic lateral sclerosis." in: Nature genetics, Vol. 40, Issue 5, pp. 572-4, 2008 (PubMed).

Alternatives for antigen "TAR DNA Binding Protein (TARDBP)", type "Antibodies"
Hosts (88), (24), (6), (1)
Reactivities (115), (67), (47), (33), (19), (19), (17), (17), (4), (3), (1)
Applications (104), (50), (21), (21), (20), (20), (10), (3), (3), (1), (1)
Conjugates (4), (4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (18), (13), (9), (7), (6), (6), (3), (3), (2), (1), (1), (1)
Beacon