TAR DNA Binding Protein (TARDBP) (Middle Region) antibody

Details for Product No. ABIN405024
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ALS10, TDP-43, Tdp43, C85084, 1190002A23Rik, wu:fb77f02, wu:fc52g10, TARDBP, TDP43, DKFZp459I2127, tardbp
Epitope
Middle Region
(17), (15), (9), (7), (7), (6), (3), (2), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human, Chicken
(109), (63), (49), (28), (16), (14), (14), (12), (4), (3), (1)
Host
Rabbit
(84), (27), (5), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(97), (47), (22), (21), (19), (18), (10), (3), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405024
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TARDBP
Sequence GISVHISNAEPKHNSNRQLERSGRFGGNPGGFGNQGGFGN SRGGGAGLGN
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against TARDBP. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TARDBP
Background HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. TARDBP is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription.HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA regulatory element (TAR) located downstream of the transcription initiation site. The protein encoded by this gene is a transcriptional repressor that binds to chromosomally integrated TAR DNA and represses HIV-1 transcription. In addition, this protein regulates alternate splicing of the CFTR gene. A similar pseudogene is present on chromosome 20.
Molecular Weight 45 kDa
Gene ID 23435
NCBI Accession NM_007375, NP_031401
UniProt Q13148
Research Area Chromatin and Nuclear Signaling, Transcription Factors, DNA/RNA, Hormones, Cytokines
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 414 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-TAR DNA Binding Protein (TARDBP) (Middle Region) antibody Immunohistochemistry with Thymus tissue at an antibody concentration of 5µg/ml using anti-TARDBP antibody (ARP35837_P050)
Background publications Kabashi, Valdmanis, Dion et al.: "TARDBP mutations in individuals with sporadic and familial amyotrophic lateral sclerosis." in: Nature genetics, Vol. 40, Issue 5, pp. 572-4, 2008 (PubMed).

Hosts (84), (27), (5), (1)
Reactivities (109), (63), (49), (28), (16), (14), (14), (12), (4), (3), (1)
Applications (97), (47), (22), (21), (19), (18), (10), (3), (2), (2), (1)
Conjugates (3), (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (17), (15), (9), (7), (7), (6), (3), (2), (2), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top