CREB/ATF BZIP Transcription Factor (CREBZF) (Middle Region) antibody

Details for Product No. ABIN405041
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SMILE, ZF, 1110034C16Rik, 6330417B10Rik, LAZip, LAZipII, Zf, RGD1565584
Epitope
Middle Region
(10), (8), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(33), (22), (6), (1)
Host
Rabbit
(32), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(33), (19), (8), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN405041
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CREBZF
Sequence GLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGV CLHVDKDKVS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against CREBZF. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CREBZF
Background CREBZF belongs to the bZIP family. It strongly activates transcription when bound to HCFC1. The protein suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. It also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. CREBZF is able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
Molecular Weight 37 kDa
Gene ID 58487
NCBI Accession NM_001039618, NP_001034707
UniProt Q9NS37
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 354 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Misra, Rapin, Akhova et al.: "Zhangfei is a potent and specific inhibitor of the host cell factor-binding transcription factor Luman." in: The Journal of biological chemistry, Vol. 280, Issue 15, pp. 15257-66, 2005 (PubMed).

Hosts (32), (1)
Reactivities (33), (22), (6), (1)
Applications (33), (19), (8), (3), (1)
Epitopes (10), (8), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top