Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405152

Zinc Finger Protein, Y-Linked (ZFY) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF911
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405152
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZFY antibody: synthetic peptide directed towards the N terminal of human ZFY
Sequence MDEDEFELQPQEPNSFFDGIGADATHMDGDQIVVEIQEAV FVSNIVDSDI
Predicted Reactivity Bovine : 100%, Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZFY. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZFY
Background ZFY is a zinc finger-containing protein that may function as a transcription factor. ZFY was once a candidate gene for the testis-determining factor (TDF) and was erroneously referred to as TDF.This gene encodes a zinc finger-containing protein that may function as a transcription factor. This gene was once a candidate gene for the testis-determining factor (TDF) and was erroneously referred to as TDF.
Molecular Weight 90kDa
Gene ID 7544
NCBI Accession NP_003402, NM_003411
UniProt P08048
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZFY antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Agate, Choe, Arnold: "Sex differences in structure and expression of the sex chromosome genes CHD1Z and CHD1W in zebra finches." in: Molecular biology and evolution, Vol. 21, Issue 2, pp. 384-96, 2004 (PubMed).

Alternatives for antigen "Zinc Finger Protein, Y-Linked (ZFY)", type "Antibodies"
Hosts (8)
Reactivities (7), (1)
Applications (8), (2)
Epitopes (2), (2), (2), (1), (1), (1)
Beacon