Did you know that you can buy products from over 140 different suppliers from us?

Sex Comb On Midleg-Like 1 (Drosophila) (SCML1) (N-Term) antibody

Details for Product No. ABIN405177
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(11), (7), (3), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Human
(32)
Host
Rabbit
(22), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(29), (14), (5), (4), (3), (2), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405177
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SCML1
Sequence MKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCM EEYQRAELEE
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against SCML1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SCML1
Background The function of SCML1 remains unknown.
Molecular Weight 23 kDa
Gene ID 6322
NCBI Accession NM_001037536, NP_001032625
UniProt Q9UN30
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 208 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Validation Images
back to top