Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405177

Sex Comb On Midleg-Like 1 (Drosophila) (SCML1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405177
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SCML1 antibody: synthetic peptide directed towards the N terminal of human SCML1
Sequence MKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCM EEYQRAELEE
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against SCML1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SCML1
Background The function of SCML1 remains unknown.
Molecular Weight 23kDa
Gene ID 6322
NCBI Accession NP_001032625, NM_001037536
UniProt Q9UN30
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SCML1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ross, Grafham, Coffey et al.: "The DNA sequence of the human X chromosome." in: Nature, Vol. 434, Issue 7031, pp. 325-37, 2005 (PubMed).

Alternatives for antigen "Sex Comb On Midleg-Like 1 (Drosophila) (SCML1)", type "Antibodies"
Hosts (14), (9)
Reactivities (23)
Applications (20), (11), (5), (3), (3), (2), (1), (1)
Epitopes (6), (3), (2), (2), (2), (1), (1), (1)
Beacon