Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405202

Jumonji Domain Containing 6 (JMJD6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PSR, Ptdsr, PtdSerR, mKIAA0585, D11Ertd195e, 5730436I23Rik, PTDSR, psr, ptdsr, zfpsr, zgc:66264, PTDSR1, GB15204, jmjd6
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405202
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-JMJD6 antibody: synthetic peptide directed towards the N terminal of human JMJD6
Sequence NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAA VADNVERADA
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 92%
Characteristics This is a rabbit polyclonal antibody against JMJD6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name JMJD6
Background JMJD6 is a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells, however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor.This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells, however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 46kDa
Gene ID 23210
NCBI Accession NP_055982, NM_015167
UniProt Q6NYC1
Research Area Embryogenesis, Embryonic stem cells, Hematopoietic Progenitors, Innate Immunity, Cytokines, Apoptosis/Necrosis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-JMJD6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Chang, Chen, Zhao et al.: "JMJD6 is a histone arginine demethylase." in: Science (New York, N.Y.), Vol. 318, Issue 5849, pp. 444-7, 2007 (PubMed).

Alternatives for antigen "Jumonji Domain Containing 6 (JMJD6)", type "Antibodies"
Hosts (51), (5)
Reactivities (56), (33), (25), (18), (17), (13), (11), (3), (3), (2), (2), (1), (1), (1), (1)
Applications (45), (21), (12), (9), (8), (4), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (14), (6), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon