Did you know that you can buy products from over 140 different suppliers from us?

Jumonji Domain Containing 6 (JMJD6) (N-Term) antibody

Details for Product No. ABIN405202
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GB15204, jmjd6, ptdsr, PTDSR, PSR, PTDSR1, 5730436I23Rik, D11Ertd195e, PtdSerR, Ptdsr, mKIAA0585, psr, zfpsr, zgc:66264, ptdsr1, cg5383
Epitope
N-Term
(19), (8), (7), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(64), (31), (27), (16), (16), (13), (11), (3), (3), (1), (1), (1), (1), (1)
Host
Rabbit
(58), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(53), (29), (14), (9), (8), (5), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405202
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human JMJD6
Sequence NHKSKKRIREAKRSARPELKDSLDWTRHNYYESFSLSPAA VADNVERADA
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 90 %
Characteristics This is a rabbit polyclonal antibody against JMJD6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name JMJD6
Background JMJD6 is a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells, however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor.This gene encodes a nuclear protein with a JmjC domain. JmjC domain-containing proteins are predicted to function as protein hydroxylases or histone demethylases. This protein was first identified as a putative phosphatidylserine receptor involved in phagocytosis of apoptotic cells, however, subsequent studies have indicated that it does not directly function in the clearance of apoptotic cells, and questioned whether it is a true phosphatidylserine receptor. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Weight 46 kDa
Gene ID 23210
NCBI Accession NM_015167, NP_055982
UniProt Q6NYC1
Research Area Embryogenesis, Embryonic stem cells, Hematopoietic Progenitors, Innate Immunity, Cytokines, Apoptosis/Necrosis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 403 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Jumonji Domain Containing 6 (JMJD6) (N-Term) antibody WB Suggested Anti-JMJD6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Chang, Chen, Zhao et al.: "JMJD6 is a histone arginine demethylase." in: Science (New York, N.Y.), Vol. 318, Issue 5849, pp. 444-7, 2007 (PubMed).

Validation Images
back to top