Did you know that you can buy products from over 140 different suppliers from us?

Notch 1 (NOTCH1) (Middle Region) antibody

Details for Product No. ABIN405215
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms notch1, NOTCH1, hn1, tan1, notch, xotch, xnotch, notch-1, xnotch1, TAN1, hN1, 9930111A19Rik, Mis6, N1, Tan1, lin-12, NOTCH, Xotch, notch1-a
Epitope
Middle Region
(30), (19), (17), (7), (6), (5), (5), (3), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Rat (Rattus), Mouse (Murine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
(116), (89), (29), (3), (2), (1)
Host
Rabbit
(88), (75), (5), (4), (3), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(10), (8), (4), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(109), (52), (47), (36), (33), (26), (16), (10), (6), (2), (1), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405215
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human NOTCH1
Sequence EHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQS QIARIPEAFK
Predicted Reactivity Chicken : 92 %, Guinea pig : 92 %, Horse : 92 %, Zebrafish : 92 %, Rat : 82 %, Bovine : 72 %, Dog : 72 %, Mouse : 72 %
Characteristics This is a rabbit polyclonal antibody against NOTCH1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NOTCH1
Background NOTCH1 is a member of the Notch family. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development.This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development.
Molecular Weight 88 kDa
Gene ID 4851
NCBI Accession NM_017617, NP_060087
UniProt P46531
Research Area Receptors, Signaling, Inflammation, Immunology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 2555 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Notch 1 (NOTCH1) (Middle Region) antibody WB Suggested Anti-NOTCH1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate
Background publications Sahlgren, Gustafsson, Jin et al.: "Notch signaling mediates hypoxia-induced tumor cell migration and invasion." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 17, pp. 6392-7, 2008 (PubMed).

Validation Images
back to top