Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405215

Notch 1 (NOTCH1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms hN1, TAN1, 9930111A19Rik, Mis6, N1, Tan1, lin-12, NOTCH, Xotch, notch, notch-1, notch1-a, xnotch, xnotch1, notch1, NOTCH1, hn1, tan1, xotch
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Zebrafish (Danio rerio), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405215
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-NOTCH1 antibody: synthetic peptide directed towards the middle region of human NOTCH1
Sequence EHPFLTPSPESPDQWSSSSPHSNVSDWSEGVSSPPTSMQS QIARIPEAFK
Predicted Reactivity Chicken : 92%, Guinea pig : 92%, Horse : 92%, Zebrafish : 92%, Rat : 85%, Bovine : 78%, Dog : 78%, Mouse : 78%
Characteristics This is a rabbit polyclonal antibody against NOTCH1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name NOTCH1
Background NOTCH1 is a member of the Notch family. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development.This gene encodes a member of the Notch family. Members of this Type 1 transmembrane protein family share structural characteristics including an extracellular domain consisting of multiple epidermal growth factor-like (EGF) repeats, and an intracellular domain consisting of multiple, different domain types. Notch family members play a role in a variety of developmental processes by controlling cell fate decisions. The Notch signaling network is an evolutionarily conserved intercellular signaling pathway which regulates interactions between physically adjacent cells. In Drosophilia, notch interaction with its cell-bound ligands (delta, serrate) establishes an intercellular signaling pathway that plays a key role in development. Homologues of the notch-ligands have also been identified in human, but precise interactions between these ligands and the human notch homologues remain to be determined. This protein is cleaved in the trans-Golgi network, and presented on the cell surface as a heterodimer. This protein functions as a receptor for membrane bound ligands, and may play multiple roles during development.
Molecular Weight 88kDa
Gene ID 4851
NCBI Accession NP_060087, NM_017617
UniProt P46531
Research Area Receptors, Signaling, Inflammation, Immunology
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-NOTCH1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Sahlgren, Gustafsson, Jin et al.: "Notch signaling mediates hypoxia-induced tumor cell migration and invasion." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 105, Issue 17, pp. 6392-7, 2008 (PubMed).

Alternatives for antigen "Notch 1 (NOTCH1)", type "Antibodies"
Hosts (84), (62), (5), (5), (3), (2)
Reactivities (119), (75), (28), (3), (2), (1), (1), (1)
Applications (90), (53), (41), (40), (27), (12), (10), (10), (5), (4), (2), (2), (2)
Conjugates (9), (7), (2), (1), (1), (1), (1), (1)
Epitopes (12), (9), (6), (5), (5), (4), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Beacon