Tripartite Motif Containing 68 (TRIM68) (Middle Region) antibody

Details for Product No. ABIN405219
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms GC109, RNF137, SS-56, SS56, Rnf137, AI894158, F730114J12Rik, TRIM68
Epitope
Middle Region
(4), (2), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human, Chicken
(15), (3), (3), (2), (2)
Host
Rabbit
(11), (4), (1)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(15), (4), (3), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN405219
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human TRIM68
Sequence VIRLRKGNEYRAGTDEYPILSLPVPPRRVGIFVDYEAHDI SFYNVTDCGS
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %
Characteristics This is a rabbit polyclonal antibody against TRIM68. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name TRIM68
Background The protein encoded by TRIM68 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. TRIM68 is expressed in many cancer cell lines. Its expression in normal tissues, however, was found to be restricted to prostate. TRIM68 was also found to be differentially expressed in androgen-dependent versus androgen-independent prostate cancer cells. The protein encoded by this gene contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. This gene is expressed in many cancer cell lines. Its expression in normal tissues, however, was found to be restricted to prostate. This gene was also found to be differentially expressed in androgen-dependent versus androgen-independent prostate cancer cells.
Molecular Weight 56 kDa
Gene ID 55128
NCBI Accession NM_018073, NP_060543
UniProt Q6AZZ1
Research Area Immunology
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 485 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 68 (TRIM68) (Middle Region) antibody WB Suggested Anti-TRIM68 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
anti-Tripartite Motif Containing 68 (TRIM68) (Middle Region) antibody (2) anti-Tripartite Motif Containing 68 (TRIM68) (Middle Region) antibody (Image 2)
Background publications Miyajima, Maruyama, Bohgaki et al.: "TRIM68 regulates ligand-dependent transcription of androgen receptor in prostate cancer cells." in: Cancer research, Vol. 68, Issue 9, pp. 3486-94, 2008 (PubMed).

Hosts (11), (4), (1)
Reactivities (15), (3), (3), (2), (2)
Applications (15), (4), (3), (3), (1)
Epitopes (4), (2), (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top