SRY (Sex Determining Region Y)-Box 17 (SOX17) (Middle Region) antibody

Details for Product No. ABIN405250
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms VUR3, Sox, sox17, Xsox17, sox17beta, sox17-beta, tSox17beta, Xsox17-beta, SOX17, Sox17alpha, Xsox17-alpha, Xsox17alpha, sox17-alpha, tSox17alpha, xSox17alpha1, xSox17alpha2, xsox17a, sox7/17
Epitope
Middle Region
(3), (2), (2), (2), (1)
Reactivity
Mouse (Murine), Dog (Canine), Human
(45), (15), (14), (12), (12), (12), (2), (2), (2), (1), (1), (1)
Host
Rabbit
(22), (18), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(25), (14), (10), (10), (8), (3), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN405250
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SOX17
Sequence RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVV SDASSAVYYC
Predicted Reactivity Human : 100 %, Guinea pig : 90 %, Dog : 80 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against SOX17. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SOX17
Background The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
Molecular Weight 44 kDa
Gene ID 64321
NCBI Accession NM_022454, NP_071899
UniProt Q9H6I2
Research Area Embryogenesis, Embryonic stem cells, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 414 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-SRY (Sex Determining Region Y)-Box 17 (SOX17) (Middle Region) antibody WB Suggested Anti-SOX17 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
anti-SRY (Sex Determining Region Y)-Box 17 (SOX17) (Middle Region) antibody (2) anti-SRY (Sex Determining Region Y)-Box 17 (SOX17) (Middle Region) antibody (Image 2)
Background publications Zhang, Glöckner, Guo et al.: "Epigenetic inactivation of the canonical Wnt antagonist SRY-box containing gene 17 in colorectal cancer." in: Cancer research, Vol. 68, Issue 8, pp. 2764-72, 2008 (PubMed).

Hosts (22), (18), (7)
Reactivities (45), (15), (14), (12), (12), (12), (2), (2), (2), (1), (1), (1)
Applications (25), (14), (10), (10), (8), (3), (1), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (3), (2), (2), (2), (1)
back to top