Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405250

SRY (Sex Determining Region Y)-Box 17 (SOX17) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms VUR3, Sox, sox17, Xsox17, sox17beta, sox17-beta, tSox17beta, Xsox17-beta, SOX17, Sox17alpha, Xsox17-alpha, Xsox17alpha, sox17-alpha, tSox17alpha, xSox17alpha1, xSox17alpha2, xsox17a, sox7/17
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN405250
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SOX17 antibody: synthetic peptide directed towards the middle region of human SOX17
Sequence RTEFEQYLHFVCKPEMGLPYQGHDSGVNLPDSHGAISSVV SDASSAVYYC
Predicted Reactivity Human : 100%, Guinea pig : 92%, Dog : 85%, Mouse : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against SOX17. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SOX17
Background The SOX17 gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. This gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins.
Molecular Weight 44kDa
Gene ID 64321
NCBI Accession NP_071899, NM_022454
UniProt Q9H6I2
Research Area Embryogenesis, Embryonic stem cells, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SOX17 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhang, Glöckner, Guo et al.: "Epigenetic inactivation of the canonical Wnt antagonist SRY-box containing gene 17 in colorectal cancer." in: Cancer research, Vol. 68, Issue 8, pp. 2764-72, 2008 (PubMed).

Alternatives for antigen "SRY (Sex Determining Region Y)-Box 17 (SOX17)", type "Antibodies"
Hosts (23), (17), (8)
Reactivities (47), (17), (16), (14), (13), (13), (4), (3), (3), (2), (2)
Applications (27), (15), (10), (10), (9), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (13), (3), (3), (2), (2)
Beacon