Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405306

Tubulin, beta 2A (TUBB2A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms TUBB, TUBB2, dJ40E16.7, Tubb2, M(beta)2, TUBB2A, beta-5, tubb2a, tubb4, tubb5, tbb3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Pig (Porcine), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405306
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TUBB2A antibody: synthetic peptide directed towards the N terminal of human TUBB2A
Sequence MAKRSRSEDEDDDLQYADHDYEVPQQKGLKKLWNRVKWTR DEDDKLKKLV
Predicted Reactivity Bovine : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%
Characteristics This is a rabbit polyclonal antibody against TUBB2A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TUBB2A
Background TUBB2A belongs to the tubulin family. Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha-chain.
Molecular Weight 50kDa
Gene ID 7280
NCBI Accession NP_001060, NM_001069
UniProt Q13885
Research Area Signaling, Cytoskeleton
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TUBB2A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Frum, Busby, Ramamoorthy et al.: "HDM2-binding partners: interaction with translation elongation factor EF1alpha." in: Journal of proteome research, Vol. 6, Issue 4, pp. 1410-7, 2007 (PubMed).

Alternatives for antigen "Tubulin, beta 2A (TUBB2A)", type "Antibodies"
Hosts (32), (11)
Reactivities (42), (15), (10), (5), (3), (3), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Applications (40), (27), (23), (14), (6), (1), (1), (1), (1), (1)
Conjugates (1), (1)
Epitopes (10), (4), (2), (2), (1), (1), (1), (1)
Beacon