Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (Middle Region) antibody

Details for Product No. ABIN405311
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SIP1, SIP1-delta, 1700012N19Rik, Sip1, sip1, sip1-delta, SMN2
Epitope
Middle Region
(17), (3), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
(54), (43), (39), (12), (12), (12), (8), (4)
Host
Rabbit
(50), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(39), (26), (20), (14), (9), (9), (7), (7), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN405311
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human SIP1
Sequence HSLIRQLARRCSEVRLLVDSKDDERVPALNLLICLVSRYF DQRDLADEPS
Predicted Reactivity Bovine :100 %,   Human :100 %,   Mouse :90 %,   Rat :90 %,  
Characteristics This is a rabbit polyclonal antibody against SIP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SIP1
Background Part of the core SMN complex which plays an essential role in spliceosomal snRNP assembly in the cytoplasm and is required for pre-mRNA splicing in the nucleus.
Molecular Weight 30 kDa
Gene ID 8487
NCBI Accession NM_001009182, NP_001009182
UniProt O14893-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 265 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Gem (Nuclear Organelle) Associated Protein 2 (GEMIN2) (Middle Region) antibody WB Suggested Anti-SIP1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Hela cell lysate
Background publications Gregory, Bert, Paterson et al.: "The miR-200 family and miR-205 regulate epithelial to mesenchymal transition by targeting ZEB1 and SIP1." in: Nature cell biology, Vol. 10, Issue 5, pp. 593-601, 2008 (PubMed).

Hosts (50), (7)
Reactivities (54), (43), (39), (12), (12), (12), (8), (4)
Applications (39), (26), (20), (14), (9), (9), (7), (7), (2), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (17), (3), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top