Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405319

Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PABP, ePAB, Pabp1, PabpI, Pabpl1, PAB1, PABP1, PABPC2, PABPL1, Pabp, fi20g03, pab-2, wu:fi20g03, zgc:55855, pab1, pabp, pabp1, pabpc2, PABPC1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405319
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PABPC1 antibody: synthetic peptide directed towards the middle region of human PABPC1
Sequence LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPAS SQVPRVMSTQ
Predicted Reactivity Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Sheep : 100%
Characteristics This is a rabbit polyclonal antibody against PABPC1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PABPC1
Background The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation. In humans, the PABPs comprise a small nuclear isoform and a conserved gene family that displays at least 3 functional proteins: PABP1 (PABPC1), inducible PABP (iPABP, or PABPC4, MIM 603407), and PABP3 (PABPC3, MIM 604680). In addition, there are at least 4 pseudogenes, PABPCP1 to PABPCP4.The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation. In humans, the PABPs comprise a small nuclear isoform and a conserved gene family that displays at least 3 functional proteins: PABP1 (PABPC1), inducible PABP (iPABP, or PABPC4, MIM 603407), and PABP3 (PABPC3, MIM 604680). In addition, there are at least 4 pseudogenes, PABPCP1 to PABPCP4.
Molecular Weight 71kDa
Gene ID 26986
NCBI Accession NP_002559, NM_002568
UniProt P11940
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PABPC1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rivera, Lloyd: "Modulation of enteroviral proteinase cleavage of poly(A)-binding protein (PABP) by conformation and PABP-associated factors." in: Virology, Vol. 375, Issue 1, pp. 59-72, 2008 (PubMed).

Alternatives for antigen "Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1)", type "Antibodies"
Hosts (42), (10)
Reactivities (49), (37), (32), (24), (17), (14), (12), (5), (4), (1), (1), (1)
Applications (35), (27), (20), (12), (11), (10), (8), (5), (2), (1), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (12), (12), (4), (2), (2), (1), (1), (1), (1)
Beacon