Did you know that you can buy products from over 140 different suppliers from us?

Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (Middle Region) antibody

Details for Product No. ABIN405319
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PABP, ePAB, Pabp1, PabpI, Pabpl1, PAB1, PABP1, PABPC2, PABPL1, Pabp, fi20g03, pab-2, wu:fi20g03, zgc:55855, pab1, pabp, pabp1, pabpc2, PABPC1
Epitope
Middle Region
(12), (12), (3), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Xenopus laevis, Human, Chicken
(49), (37), (33), (24), (17), (13), (12), (4), (4), (1)
Host
Rabbit
(43), (9)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(35), (25), (20), (13), (12), (11), (9), (8), (4), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN405319
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human PABPC1
Sequence LRPSPRWTAQGARPHPFQNMPGAIRPAAPRPPFSTMRPAS SQVPRVMSTQ
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Sheep : 100 %
Characteristics This is a rabbit polyclonal antibody against PABPC1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name PABPC1
Background The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation. In humans, the PABPs comprise a small nuclear isoform and a conserved gene family that displays at least 3 functional proteins: PABP1 (PABPC1), inducible PABP (iPABP, or PABPC4, MIM 603407), and PABP3 (PABPC3, MIM 604680). In addition, there are at least 4 pseudogenes, PABPCP1 to PABPCP4.The poly(A)-binding protein (PABP), which is found complexed to the 3-prime poly(A) tail of eukaryotic mRNA, is required for poly(A) shortening and translation initiation. In humans, the PABPs comprise a small nuclear isoform and a conserved gene family that displays at least 3 functional proteins: PABP1 (PABPC1), inducible PABP (iPABP, or PABPC4, MIM 603407), and PABP3 (PABPC3, MIM 604680). In addition, there are at least 4 pseudogenes, PABPCP1 to PABPCP4.
Molecular Weight 71 kDa
Gene ID 26986
NCBI Accession NM_002568, NP_002559
UniProt P11940
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 636 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly(A) Binding Protein, Cytoplasmic 1 (PABPC1) (Middle Region) antibody WB Suggested Anti-PABPC1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Rivera, Lloyd: "Modulation of enteroviral proteinase cleavage of poly(A)-binding protein (PABP) by conformation and PABP-associated factors." in: Virology, Vol. 375, Issue 1, pp. 59-72, 2008 (PubMed).

Hosts (43), (9)
Reactivities (49), (37), (33), (24), (17), (13), (12), (4), (4), (1)
Applications (35), (25), (20), (13), (12), (11), (9), (8), (4), (1), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (12), (12), (3), (2), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top