Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2) (N-Term) antibody

Details for Product No. ABIN405337
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SMD2, Sm-D2, SNRPD1, smd2, sm-d2, snrpd1, 1810009A06Rik, im:6908977, si:dkey-113g17.2, zgc:110732, SNRPD2, 170.t00019, NCU03778.1
Epitope
N-Term
(3), (3), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Pig (Porcine), Dog (Canine), Human
(18), (4), (4), (1), (1), (1), (1)
Host
Rabbit
(20)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2)
Application
Western Blotting (WB)
(20), (10), (10), (3), (1)
Pubmed 1 reference available
Catalog no. ABIN405337
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SNRPD2
Sequence MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNT QVLINCRNNK
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Mouse : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against SNRPD2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SNRPD2
Background SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Molecular Weight 13 kDa
Gene ID 6633
NCBI Accession NM_004597, NP_004588
UniProt P62316
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 118 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2) (N-Term) antibody WB Suggested Anti-SNRPD2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome...." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Hosts (20)
Reactivities (18), (4), (4), (1), (1), (1), (1)
Applications (20), (10), (10), (3), (1)
Conjugates (2), (2), (2)
Epitopes (3), (3), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top