Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405337

Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SMD2, Sm-D2, SNRPD1, smd2, sm-d2, snrpd1, 1810009A06Rik, im:6908977, si:dkey-113g17.2, zgc:110732, SNRPD2, 170.t00019, NCU03778.1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Cow (Bovine), Pig (Porcine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405337
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SNRPD2 antibody: synthetic peptide directed towards the N terminal of human SNRPD2
Sequence MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNT QVLINCRNNK
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Mouse : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against SNRPD2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SNRPD2
Background SNRPD2 belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Multiple transcript variants encoding different isoforms have been found for this gene.The protein encoded by this gene belongs to the small nuclear ribonucleoprotein core protein family. It is required for pre-mRNA splicing and small nuclear ribonucleoprotein biogenesis. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified.
Molecular Weight 13kDa
Gene ID 6633
NCBI Accession NP_004588, NM_004597
UniProt P62316
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SNRPD2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Stelzl, Worm, Lalowski et al.: "A human protein-protein interaction network: a resource for annotating the proteome." in: Cell, Vol. 122, Issue 6, pp. 957-68, 2005 (PubMed).

Alternatives for antigen "Small Nuclear Ribonucleoprotein D2 Polypeptide 16.5kDa (SNRPD2)", type "Antibodies"
Hosts (15)
Reactivities (13), (3), (3), (1), (1), (1), (1)
Applications (15), (8), (7), (3), (1)
Conjugates (1), (1), (1)
Epitopes (4), (3), (1), (1)
Beacon