Nucleolar Protein 6 (NOL6) (N-Term) antibody

Details for Product No. ABIN405371
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms NRAP, UTP22, bA311H10.1, AA410091, Nrap, nrap, utp22
Epitope
N-Term
(2), (2), (2), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Human
(12), (3), (3), (1)
Host
Rabbit
(8), (4), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(12), (4), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN405371
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human NOL6
Sequence SRKRTLAEPPAKGLLQPVKLSRAELYKEPTNEELNRLRET EILFHSSLLR
Predicted Reactivity Dog : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rat : 100 %, Bovine : 90 %, Rabbit : 90 %, African clawed frog : 70 %, Chicken : 70 %
Characteristics This is a rabbit polyclonal antibody against NOL6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name NOL6
Background NOL6 is a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. The nucleolus is a dense subnuclear membraneless organelle that assembles around clusters of rRNA genes and functions in ribosome biogenesis. This gene encodes a nucleolar RNA-associated protein that is highly conserved between species. RNase treatment of permeabilized cells indicates that the nucleolar localization is RNA dependent. Further studies suggest that the protein is associated with ribosome biogenesis through an interaction with pre-rRNA primary transcripts. Alternative splicing has been observed at this locus and two splice variants encoding distinct isoforms have been identified.
Molecular Weight 127 kDa
Gene ID 65083
NCBI Accession NM_022917, NP_075068
UniProt Q9H6R4
Research Area Chromatin and Nuclear Signaling, DNA/RNA
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1146 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Nucleolar Protein 6 (NOL6) (N-Term) antibody WB Suggested Anti-NOL6 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: 721_B cell lysate
Background publications Nousiainen, Silljé, Sauer et al.: "Phosphoproteome analysis of the human mitotic spindle." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 103, Issue 14, pp. 5391-6, 2006 (PubMed).

Hosts (8), (4), (2)
Reactivities (12), (3), (3), (1)
Applications (12), (4), (4), (3), (2)
Epitopes (2), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top