Arylsulfatase E (ARSE) (Middle Region) antibody

Details for Product No. ABIN405416
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASE, CDPX, CDPX1, CDPXR, ARSE, MGC155058
Epitope
Middle Region
(3), (1), (1), (1), (1)
Reactivity
Human
(11)
Host
Rabbit
(10), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(10), (5), (1)
Pubmed 1 reference available
Catalog no. ABIN405416
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human ARSE
Sequence KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQ AVWEHQRTLS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ARSE. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ARSE
Background Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.
Molecular Weight 62 kDa
Gene ID 415
NCBI Accession NM_000047, NP_000038
UniProt P51690
Research Area Organogenesis, Organelles
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 589 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Nino, Matos-Miranda, Maeda et al.: "Clinical and molecular analysis of arylsulfatase E in patients with brachytelephalangic chondrodysplasia punctata." in: American journal of medical genetics. Part A, Vol. 146A, Issue 8, pp. 997-1008, 2008 (PubMed).

Hosts (10), (2)
Reactivities (11)
Applications (10), (5), (1)
Epitopes (3), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top