Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405416

Arylsulfatase E (ARSE) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ASE, CDPX, CDPX1, CDPXR, ARSE, MGC155058
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405416
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ARSE antibody: synthetic peptide directed towards the middle region of human ARSE
Sequence KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQ AVWEHQRTLS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ARSE. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ARSE
Background Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.
Molecular Weight 62kDa
Gene ID 415
NCBI Accession NP_000038, NM_000047
UniProt P51690
Research Area Organogenesis, Organelles
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ARSE antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Nino, Matos-Miranda, Maeda et al.: "Clinical and molecular analysis of arylsulfatase E in patients with brachytelephalangic chondrodysplasia punctata." in: American journal of medical genetics. Part A, Vol. 146A, Issue 8, pp. 997-1008, 2008 (PubMed).

Alternatives for antigen "Arylsulfatase E (ARSE)", type "Antibodies"
Hosts (9), (1)
Reactivities (9)
Applications (8), (4)
Epitopes (1), (1), (1), (1), (1)
Beacon