Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405420

Keratin 10 (KRT10) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BCIE, BIE, CK10, EHK, K10, KPP, K1C1, Krt1-10, Krt-1.10, D130054E02Rik, Ka10, Ker10, KRT10, KRT9
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405420
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KRT10 antibody: synthetic peptide directed towards the N terminal of human KRT10
Sequence EKVTMQNLNDRLASYLDKVRALEESNYELEGKIKEWYEKH GNSHQGEPRD
Predicted Reactivity Mouse : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against KRT10. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KRT10
Background KRT10 is a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in the gene encoding KRT10 are associated with epidermolytic hyperkeratosis. This gene encodes a member of the type I (acidic) cytokeratin family, which belongs to the superfamily of intermediate filament (IF) proteins. Keratins are heteropolymeric structural proteins which form the intermediate filament. These filaments, along with actin microfilaments and microtubules, compose the cytoskeleton of epithelial cells. Mutations in this gene are associated with epidermolytic hyperkeratosis. This gene is located within a cluster of keratin family members on chromosome 17q21.
Molecular Weight 59kDa
Gene ID 3858
NCBI Accession NP_000412, NM_000421
UniProt P13645
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KRT10 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Tsubota, Akiyama, Kanitakis et al.: "Mild recessive bullous congenital ichthyosiform erythroderma due to a previously unidentified homozygous keratin 10 nonsense mutation." in: The Journal of investigative dermatology, Vol. 128, Issue 7, pp. 1648-52, 2008 (PubMed).

Alternatives for antigen "Keratin 10 (KRT10)", type "Antibodies"
Hosts (78), (68), (3)
Reactivities (138), (50), (43), (28), (26), (26), (12), (7), (3)
Applications (85), (72), (33), (30), (28), (27), (25), (20), (19), (12), (11), (5)
Conjugates (7), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (5), (4), (4), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Beacon