Did you know that you can buy products from over 140 different suppliers from us?

Angiotensin II Receptor, Type 1 (AGTR1) (N-Term) antibody

Details for Product No. ABIN405448
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AGTR1B, AT1, XAT-1, agtr1-A, agtr1.2, at2, AGTR2, zgc:113016, at2r, atgr2, mrx88, AG2S, AGTR1A, AT1AR, AT1B, AT1BR, AT1R, AT2R1, AT2R1A, AT2R1B, HAT1R, at1, AT1-R, 1810074K20Rik, AI551199, AT1a, Agtr- ... show more
AGTR1B, AT1, XAT-1, agtr1-A, agtr1.2, at2, AGTR2, zgc:113016, at2r, atgr2, mrx88, AG2S, AGTR1A, AT1AR, AT1B, AT1BR, AT1R, AT2R1, AT2R1A, AT2R1B, HAT1R, at1, AT1-R, 1810074K20Rik, AI551199, AT1a, Agtr-1a, Agtr1, Angtr-1a, AT3, AT1R, Agtr-1b, Angtr-1b, AGTR1 show less
Epitope
N-Term
(9), (7), (5), (3), (3), (3), (3), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
(69), (56), (50), (24), (1)
Host
Rabbit
(64), (5), (4), (4), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Application
Western Blotting (WB)
(58), (34), (20), (14), (11), (11), (6), (4), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN405448
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human AGTR1
Sequence ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVV GIFGNSLVVI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Rabbit : 100 %, Sheep : 100 %, Mouse : 90 %, Pig : 90 %
Characteristics This is a rabbit polyclonal antibody against AGTR1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name AGTR1
Background Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. AGTR1 is the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. AGTR1 may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed, however, it is now believed that there is only one type 1 receptor gene in humans.Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed, however, it is now believed that there is only one type 1 receptor gene in humans. At least five transcript variants have been described for this gene. Additional variants have been described but their full-length nature has not been determined. The entire coding sequence is contained in the terminal exon and is present in all transcript variants.
Molecular Weight 41 kDa
Gene ID 185
NCBI Accession NM_004835, NP_004826
UniProt P30556
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 359 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Angiotensin II Receptor, Type 1 (AGTR1) (N-Term) antibody WB Suggested Anti-AGTR1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human heart
Background publications Kurland, Hallberg, Melhus et al.: "The relationship between the plasma concentration of irbesartan and the antihypertensive response is disclosed by an angiotensin II type 1 receptor polymorphism: results from the Swedish Irbesartan Left Ventricular Hypertrophy Investigation vs. Atenolol (" in: American journal of hypertension, Vol. 21, Issue 7, pp. 836-9, 2008 (PubMed).

Validation Images
back to top