Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405448

Angiotensin II Receptor, Type 1 (AGTR1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
AG2S, AGTR1A, AGTR1B, AT1, AT1AR, AT1B, AT1BR, AT1R, AT2R1, AT2R1A, AT2R1B, HAT1R, AT3, Agtr1, AT1R, AT1-R, AGTR1, Agtr-1b, Angtr-1b, at1, XAT-1, agtr1-A, agtr1.2, at2, AT2, AGTR2, zgc:1130 ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rabbit, Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405448
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1
Sequence ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVV GIFGNSLVVI
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Rabbit : 100%, Sheep : 100%, Mouse : 92%, Pig : 92%
Characteristics This is a rabbit polyclonal antibody against AGTR1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name AGTR1
Background Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. AGTR1 is the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. AGTR1 may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed, however, it is now believed that there is only one type 1 receptor gene in humans.Angiotensin II is a potent vasopressor hormone and a primary regulator of aldosterone secretion. It is an important effector controlling blood pressure and volume in the cardiovascular system. It acts through at least two types of receptors. This gene encodes the type 1 receptor which is thought to mediate the major cardiovascular effects of angiotensin II. This gene may play a role in the generation of reperfusion arrhythmias following restoration of blood flow to ischemic or infarcted myocardium. It was previously thought that a related gene, denoted as AGTR1B, existed, however, it is now believed that there is only one type 1 receptor gene in humans. At least five transcript variants have been described for this gene. Additional variants have been described but their full-length nature has not been determined. The entire coding sequence is contained in the terminal exon and is present in all transcript variants.
Molecular Weight 41kDa
Gene ID 185
NCBI Accession NP_004826, NM_004835
UniProt P30556
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-AGTR1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kurland, Hallberg, Melhus et al.: "The relationship between the plasma concentration of irbesartan and the antihypertensive response is disclosed by an angiotensin II type 1 receptor polymorphism: results from the Swedish Irbesartan Left Ventricular Hypertrophy Investigation vs. Atenolol (" in: American journal of hypertension, Vol. 21, Issue 7, pp. 836-9, 2008 (PubMed).

Alternatives for antigen "Angiotensin II Receptor, Type 1 (AGTR1)", type "Antibodies"
Hosts (62), (6), (4), (4), (3)
Reactivities (67), (56), (50), (24), (1)
Applications (57), (38), (20), (15), (15), (13), (7), (5), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (12), (7), (5), (4), (3), (3), (3), (2), (2), (1), (1), (1), (1)
Beacon