Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN405544

HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700042J16Rik, A730034A22Rik, BC025474, HACE1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Dog (Canine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN405544
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HACE1 antibody: synthetic peptide directed towards the middle region of human HACE1
Sequence DVSDWIKNTEYTSGYEREDPVIQWFWEVVEDITQEERVLL LQFVTGSSRV
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, African clawed frog : 85%, Chicken : 85%
Characteristics This is a rabbit polyclonal antibody against HACE1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name HACE1
Background HACE1 contains 6 ANK repeats and 1 HECT (E6AP-type E3 ubiquitin-protein ligase) domain. HACE1 is an E3 ubiquitin-protein ligase that may function in cellular proteins degradation.
Molecular Weight 102kDa
Gene ID 57531
NCBI Accession NP_065822, NM_020771
UniProt Q8IYU2
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HACE1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Zhang, Anglesio, OSullivan et al.: "The E3 ligase HACE1 is a critical chromosome 6q21 tumor suppressor involved in multiple cancers." in: Nature medicine, Vol. 13, Issue 9, pp. 1060-9, 2007 (PubMed).

Alternatives for antigen "HECT Domain and Ankyrin Repeat Containing, E3 Ubiquitin Protein Ligase 1 (HACE1)", type "Antibodies"
Hosts (19), (5)
Reactivities (23), (16), (13), (12), (12), (12), (12), (3), (1)
Applications (14), (13), (10), (6), (4), (3)
Conjugates (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1)
Beacon